Conserved Protein Domain Family
PHA_synth_III_C

?
TIGR01836: PHA_synth_III_C 
poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit
This model represents the PhaC subunit of a heterodimeric form of polyhydroxyalkanoic acid (PHA) synthase. Excepting the PhaC of Bacillus megaterium (which needs PhaR), all members require PhaE (TIGR01834) for activity and are designated class III. This enzyme builds ester polymers for carbon and energy storage that accumulate in inclusions, and both this enzyme and the depolymerase associate with the inclusions. Class III enzymes polymerize short-chain-length hydroxyalkanoates. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 130895
View PSSM: TIGR01836
Aligned: 6 rows
Threshold Bit Score: 550.879
Threshold Setting Gi: 22797878
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172475     4 IDIRPDKLAQEMLDYTS------KLGQGMENLL--NADaIDTGVSPKEAVYSEDKLVLYRYDTPAGVtpQKTPLLIVYAL 75
gi 22797878    6 NNSLINYLVNDYFTFVRdpdnisKLKEIRKKLS--NIEnIKTGSSEYEVIRETTLFRLLHYKPLKQQt-FKYPLLIVYAL 82
gi 4160475     9 WEKLIKSMPSEYKSSAR------RFKRAYEIMT--TEAePEVGLTPKEVIWKKNKAKLYRYTPVKDNl-HKTPILLVYAL 79
gi 500032118   4 LQLTPQSIAQELADFNK------NLAEGYKNLA--ELGpIEVGTSDKEVVYREDKMVLYRFTPQVKKp-HAVPMLIVYAL 74
gi 499348011   5 LGFSAEDLMQETLSMQR------KLREGLKLLP--GVEdVDYGVTERQEVWRDGKVVLYRFVGDAAPv-ARTPLLIVYAL 75
gi 499174473  19 AQVGLEENLHETLDFTE------KFLSGLENLQglNEDdIQVGFTPKEAVYQEDKVILYRFQPVVENp-LPIPVLIVYAL 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172475    76 VNRPYMTDIQEDRSTIKGLLATGQDVYLIDWGYPDQADSALTLDDYINGYIDSCVDYLCETHEVDQVNILGICQGGAFSL 155
gi 22797878   83 INKSYILDLQNDKSWIRNLLEQGINVYLIDWKPPSKLDKYITVDDYVNLFIYECVEYIKNIENIDQISLQGYCMGGTMSL 162
gi 4160475    80 INKPYILDLTPGNSLVEYLLNRGFDVYLLDWGTPGLEDSNMKLDDYIVDYIPKAAKKVLRTSKSPDLSVLGYCMGGTMTS 159
gi 500032118  75 VNRPYMTDLQEDRSTIRGLLEEGMDVYLIDWGYPDAADRYLGLEDYVDGYIKRSVNHICRSHDLDAINLLGICQGGAFSL 154
gi 499348011  76 VNRPYMVDLQADRSLVKGLLGHGQDVYVLDWGYPDRSERYLTLEDYLLRYIDGAVDHLRAASGLEAVDVLGICQGGTFAL 155
gi 499174473  92 VNRPYMVDLQEGRSLVANLLKLGLDVYLIDWGYPSRGDRWLTLEDYLSGYLNNCVDIICQRSQQEKITLLGVCQGGTFSL 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172475   156 MYASLHPDK-VKNLVTMVTPVDFKTPGNLLSAW------VQNVDIDLAVDTMGNIPGELLNWTFLSLKPFSLTGQKYVNM 228
gi 22797878  163 MYTSLYQKN-IKNLVTIAPIVDAEKDKSVIKNM------AEHMDIDKVLSYHENFPYELLYLVYASLKPFKQGVNKYYNL 235
gi 4160475   160 IFAALNEDLpIKNLIFMTSPFDFSDTGLYGAFLd-----DRYFNLDKAVDTFGNIPPEMIDFGNKMLKPITNFYGPYVTL 234
gi 500032118 155 CFAALYPEK-VKNLVTMVTPVDFQTPDNMLSLW------ARHLDVDLLVETMGNVPGELLNFTFLSMKPFSLTGQKYLDL 227
gi 499348011 156 CYAALERAK-IRNLITMVTPVDFHTPDNMLSNW------ARMVDVDLFVDTMGNVPADLMNASYLMLKPFRLNLQKYVGL 228
gi 499174473 172 CYASLFPDK-VKNLVVMVAPVDFEQPGTLLNARggctlgAEAVDIDLMVDAMGNIPGDYLNLEFLMLKPLQLGYQKYLDV 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172475   229 VDMLDDPDKVKNFLRMEKWIFDSPDQAGETFRQFTKDFYQKNGFINGGVKLGGKEIDLKNVDCPVLNIYALQDHLVPPDA 308
gi 22797878  236 FKNFEDESFVQNFLRIEKWLYDTPPIAGETFRQWVKDIYQQNLFAKNKMIVGENKINLSNIKVPVLNVVAEFDHLVTSDS 315
gi 4160475   235 VDRSENQRFVESWKLMQKWVADGIPFAGEAYRQWIRDFYQQNKLINGELEVRGRKVDLKNIKANILNIAASRDHIAMPHQ 314
gi 500032118 228 VEIMQDKTKLCNFMRMEKWIFDSPDQAGEAFRQFIKMFYQENGLVNGTAQIGGKEVKLENITMPILNIYATLDHLVPPAA 307
gi 499348011 229 LDILDDKQALEDFLRMEKWIFDSPDLAGEAFREFVTQFYQRNGLVTGDVRIGGQAVDLHAVDMPVLNIYAEHDHLVPPDA 308
gi 499174473 251 PDIMGDEAKLLNFLRMEKWIFDSPDQAGETYRQFLKDFYQQNKLIKGEVMIGDRLVDLHNLTMPILNLYAEKDHLVAPAS 330
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*..
gi 1172475   309 SKALNPWSAA-RTYTELAFPGGHIGIYVSGKAQKEVTPAIGKWLNER 354
gi 22797878  316 SSSLNNLISS-QDKSLMKFPTGHVGLIASNFSQKNVLPKIGKWIQTH 361
gi 4160475   315 VAALMDAVSS-EDKEYKLLQTGHVSVVFGPKAVKETYPSIGDWLEKR 360
gi 500032118 308 SKVLKGLVGS-TDYTELPFKGGHIGIYVSGRAQREVPPSIANWLKAR 353
gi 499348011 309 SRALRGLVGS-EDYTELSFRGGHIGIYVSGRAQREVPVAIHRWLQAR 354
gi 499174473 331 SLALGDYLPEnCDYTVQSFPVGHIGMYVSGKVQRDLPPAIAHWLSER 377
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap