Conserved Protein Domain Family
PHA_granule_1

?
TIGR01837: PHA_granule_1 
poly(hydroxyalkanoate) granule-associated protein
This model describes a domain found in some proteins associated with polyhydroxyalkanoate (PHA) granules in a subset of species that have PHA inclusion granules. Included are two tandem proteins of Pseudomonas oleovorans, PhaI and PhaF, and their homologs in related species. PhaF proteins have a low-complexity C-terminal region with repeats similar to AAAKP. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 130896
View PSSM: TIGR01837
Aligned: 5 rows
Threshold Bit Score: 126.794
Threshold Setting Gi: 22971625
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3955016    18 EVRGYARKIWLAGIGAYARVGQEGSDYFNELVKAGEGVEKRGKKRIDKELDAANnqiDEATQEVSRVRGKVEVQLDKIEK 97
gi 20502373   17 KVEDYSRKIWLAGLGVYSKIDTDGSKLFDTLVKDGEKAEKLTKSAVGKKVDAAKdsaQSAKSRVGDVKDRALGKWGELEE 96
gi 22971625   26 QVFEVVRKLMLAGIGAFALSREEAEAFLNRLVERGELAQKDAQKLFDEAMERFR------KTALPQT-DQVQTNLNNLTA 98
gi 490191960  31 RLGKSAERVWLAGIGALGRVQSEGARFFEALVNEGEEIKQRRRESSLHSAESIR---EHVEVKLEETWENTQRNWRRMNQ 107
gi 489581372  28 RLGESAQTVWLAGLGALGRVQNEGSKLFDSLVREGAAYERTGQRRAAESVDELR---EEVETQFEQARDTAVRGWDKLGK 104
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 3955016    98 AFDARVGRALNRLGIPSKHDVEALSIKLEQLHELLERVAHK 138
gi 20502373   97 AFDKRLNSAISRLGVPSRNEVKALHSKVDTLTKQIERLTGA 137
gi 22971625   99 QVETSFEQFLNRLNIPSKRDIDELSAKIAQLAVRVEELRRA 139
gi 490191960 108 LFDERIQDILHTLKIPTREEIEALRHEIEILRNELHELRNE 148
gi 489581372 105 AFDERVKGVLRTLNIPEQEELENLRREVESLKAQVRANTAA 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap