Conserved Protein Domain Family
PHA_synth_II

?
TIGR01839: PHA_synth_II 
poly(R)-hydroxyalkanoic acid synthase, class II
This model represents the class II subfamily of poly(R)-hydroxyalkanoate synthases, which polymerizes hydroxyacyl-CoAs, typically with six to fourteen carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 130898
View PSSM: TIGR01839
Aligned: 3 rows
Threshold Bit Score: 1115
Threshold Setting Gi: 129993
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130005      1 MKDKPAKGTPTLPATSMNVQNAILGLRGRDLISTLRNVSRQSLRHPLHTAHHLLALGGQLGRVILGDTPLQPNPRDPRFS 80
gi 129993      1 MSNKNNDELQRQASENTLGLNPVIGIRRKDLLSSARTVLRQAVRQPLHSAKHVAHFGLELKNVLLGKSSLAPESDDRRFN 80
gi 489206665   1 MREKQESGSVPVPAEFMSAQSAIVGLRGKDLLTTVRSLAVHGLRQPLHSARHLVAFGGQLGKVLLGDTLHQPNPQDARFQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130005     81 DPTWSQNPFYRRGLQAYLAWQKQTRLWIEESHLDDDDRARAHFLFNLINDALAPSNSLLNPLAVKELFNSGGQSLVRGVA 160
gi 129993     81 DPAWSNNPLYRRYLQTYLAWRKELQDWIGNSDLSPQDISRGQFVINLMTEAMAPTNTLSNPAAVKRFFETGGKSLLDGLS 160
gi 489206665  81 DPSWRLNPFYRRTLQAYLAWQKQLLAWIDESNLDCDDRARARFLVALLSDAVAPSNSLINPLALKELFNTGGISLLNGVR 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130005    161 HLLDDLRHNDGLPRQVDERAFEVGGNLAATAGAVVFRNELLELIQYKPMSEKQHARPLLVVPPQINKFYIFDLSSTNSFV 240
gi 129993    161 NLAKDLVNNGGMPSQVNMDAFEVGKNLGTSEGAVVYRNDVLELIQYKPITEQVHARPLLVVPPQINKFYVFDLSPEKSLA 240
gi 489206665 161 HLLEDLVHNGGMPSQVNKTAFEIGRNLATTQGAVVFRNEVLELIQYKPLGERQYAKPLLIVPPQINKYYIFDLSPEKSFV 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130005    241 QYMLKNGLQVFMVSWRNPDPRHREWGLSSYVQALEEALNACRSISGNRDPNLMGACAGGLTMAALQGHLQAKHQLrRVRS 320
gi 129993    241 RYCLRSQQQTFIISWRNPTKAQREWGLSTYIDALKEAVDAVLAITGSKDLNMLGACSGGITCTALVGHYAALGEN-KVNA 319
gi 489206665 241 QYALKNNLQVFVISWRNPDAQHREWGLSTYVEALDQAIEVSREITGSRSVNLAGACAGGLTVAALLGHLQVRRQLrKVSS 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130005    321 ATYLVSLLDSKFESPASLFADEQTIEAAKRRSYQRGVLDGAEVARIFAWMRPNDLIWNYWVNNYLLGKTPPAFDILYWNA 400
gi 129993    320 LTLLVSVLDTTMDNQVALFVDEQTLEAAKRHSYQAGVLEGSEMAKVFAWMRPNDLIWNYWVNNYLLGNEPPVFDILFWNN 399
gi 489206665 321 VTYLVSLLDSQMESPAMLFADEQTLESSKRRSYQHGVLDGRDMAKVFAWMRPNDLIWNYWVNNYLLGRQPPAFDILYWNN 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130005    401 DSTRLPAALHGDLLDFFKLNPLTHPAGLEVCGTPIDLQKVELDSFTVAGSNDHITPWDAVYRSALLLGGDRRFVLANSGH 480
gi 129993    400 DTTRLPAAFHGDLIEMFKSNPLTRPDALEVCGTPIDLKQVKCDIYSLAGTNDHITPWQSCYRSAHLFGGKIEFVLSNSGH 479
gi 489206665 401 DNTRLPAAFHGELLDLFKHNPLTRPGALEVSGTAVDLGKVAIDSFHVAGITDHITPWDAVYRSALLLGGQRRFILSNSGH 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130005    481 IQSIINPPGNPKAYYLANPKLSSDPRAWLHDAKRSEGSWWPLWLEWITARSGPLKAPRSELGNATYPPLGPAPGTYVLTR 560
gi 129993    480 IQSILNPPGNPKARFMTGADRPGDPVAWQENATKHADSWWLHWQSWLGERAGELEKAPTRLGNRAYAAGEASPGTYVHER 559
gi 489206665 481 IQSILNPPGNPKACYFENDKLSSDPRAWYYDAKREEGSWWPVWLGWLQERSGELGNPDFNLGSAAHPPLEAAPGTYVHIR 560
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap