Conserved Protein Domain Family
type_I_hlyD

?
TIGR01843: type_I_hlyD 
type I secretion membrane fusion protein, HlyD family
Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 130902
View PSSM: TIGR01843
Aligned: 14 rows
Threshold Bit Score: 449.075
Threshold Setting Gi: 15964852
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123210     54 SRRPRLVAYFIMGFLVIAFILSVLGQVEIVATANGKLTHSGRSKEIKPIENSIVKEIIVKEGESVRKGDVLLKLTALGAE 133
gi 500032900  48 SPFGRLITWTIMLFCALAVGWSIWGQIDVVAVAQGKILPNGHVKVIQPLEIGVVREIPVREGEQVAEGEVLVILDPTSTE 127
gi 500033823  25 GLAGWIYIPLFFGFVISLGVWAYFGVLDVVTFTTGEVVPSSQIKHVQHLEGGILRVIHVKEGEEVKLGQPLIELESIADE 104
gi 499221353  14 QAVARIGYGIIALTFVGLLGWAAFAPLDSAVIANGVVSAEGNRKTVQHLEGGMLAKILVREGEKVKAGQVLFELDPTQAN 93
gi 500031693  38 SRLLKIATVAVAGAILIFFIWANFANMEEVAHTTGEVATTDTIQFAQHLEGGIVGEIFIEEGQRVTQGQPLAQMKSEDVL 117
gi 499386378  26 KRIIKQITYFIAGSVFIMFVWSLFTNIEEIAKAKGQVIPLGHQQVIQSFSGGTLASILVSEGDLVKKGDVLANFIAIDSQ 105
gi 499283050  17 SRHLIGVSVLALALVAGVGGWAATTELSSAIVAGGVVIVDDNVKKVQHLTGGIVGELLVKEGDRVEAGQVLIRLDGTTVR 96
gi 499386511  25 PSGHRLIIWALAAMVACFLLWAGFAELDTVTTGSGKVIPSSQVQVIQSLDGGIMQELFVRDGDLVTKGQPLVRIDDTRFR 104
gi 499272914  25 RLHTLLGLALIAISFGGFGYWAFAAPLAAAIIAQGSFVANGNNKIVQHLEGGIIEELLVAEGDKVKAGDILVKLDQTVAR 104
gi 575874637 291 KRFSRLGWGLVLLGFVGFLLWAGLAPLDKGVGVSGTVMVAGSRKAVQHPTGGLVRHIRVHEGERVEAGQVLLEMDATQAR 370
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123210    134 ADTLKTQSSLLQARLEQTRYQILSRsIEL-----------------NKLPELKLPDEpY-FqnVSEEEVLRLTSLIKEQF 195
gi 500032900 128 ADLVRFEENLLSAQLDMARWQALAE-WDQ-----------------GEQPQILYRSP-D-G--APEGRVQKQRWLLKDTL 185
gi 500033823 105 SDLSELTARMVGLQLDIIRHDAAAKlAAH-----------------PDYPPELVS--------KYPQLVKQSRALFEARA 159
gi 499221353  94 AAAGITRNQYVALKAMEARLLAERDqRPS-----------------ISFPADLTSQRaD-P--MVARAIADEQAQFTERR 153
gi 500031693 118 AEYNQMHAREAILALQVAQKRALINsEP------------------IDLSGIER------P--LFDHMIAESVDFLDAQR 171
gi 499386378 106 AAAEELESKQANLVLKIERYSAFIEsREA-----------------N-FASYLES---------HPNLVKGHISDLERMN 158
gi 499283050  97 ANLAIIESTLAQFYARRARLQAERMgAAS-----------------FEIEEDLAEFIpG-T--AAAKLIEGEQRLFASRR 156
gi 499386511 105 SDFAQQEQEVFGLKTNAIRMRAELDsILIsdmtsdwreqvkitkkdLVFPDSIIQAE--------PALVKRQQEEYSGRL 176
gi 499272914 105 ANARMLNLKRLRLEAVVGRLRAEAVgEDA-----------------FSVPQIVARQA-DdP--DVRAIMESQNVNFQSKK 164
gi 575874637 371 AQADGLFAQYLAALASLARLSAERDeKAR-----------------IEFPAELLALD-D-P--RLPTLLEQQRQLHDSRR 429
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123210    196 STWQNQKYQKELNLDKKRAERLTVLARINRYENLSRVEKSRLDDFSSLLHKQAIAKHAVLEQENKYVEAVNELRVYKSQL 275
gi 500032900 186 LAHRASLQGIGHELKKQMAELASAKEAVRKYQQLLPLIAKRANAQKTLMEKKLAAQSHWLELEQERVELQRDLAIQKSRL 265
gi 500033823 160 STLHGEKVEMLNHYKENESLLGEIRARLRNSRERMKFLHEQVKISENLLKDELTSRLDHLALLRQERKLQSDIDEDEAGI 239
gi 499221353 154 QTIQGQVDLMNAQRLQYQSEIEGIDRQTQGLKDQLGFIEDELIDLRKLYDKGLVPRPRLLALEREQASLSGSIGRLTADR 233
gi 500031693 172 TSLASQREVILIQVKQKEMKLKKLLNQAQANRQQVQYYNEELEVRRPLTERKLMSRLQTLSAMQSREKTRADMLESEGDV 251
gi 499386378 159 NEKQAIIQSSLAEIAKSKAELASLDQEIPPLKHQITSAQQTINMMESIKESQAVSKLTMLESQQKLDSYIRELKSMEGKQ 238
gi 499283050 157 SALSGMKGQLDSRKAQLADEVEGLTVQLNAIEEALKLIAEELTGVDSLFGQGLVPMQRVTTLKRQRAELEGGRGRHIAAR 236
gi 499386511 177 DNLSNQLEILVRQIQQRQQEIDDLASKTTTLTTSMQLISRELELTRPLAKKGIVPEVELLKLERAVNDAQGELNSLRLLR 256
gi 499272914 165 IKLRDQLNLIDQNIRSLEFRARGYALQQASFNRQLEILNEEREAKSKLADKGLIRRPELMALDRAIADAIGEIGRLESEV 244
gi 575874637 430 RALRLELDGLAETVAGSQAQLDGLQAALRSKEQQRAALEEQLRGLRQLASEGYVPRNRLLDSERLLAQVNGEIAGDLGSL 509
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123210    276 EQIESEILSAKEEYQLVTQLFKNEILDKLRQTTDNIGLLTLELAKNEERQQASVIRAPVSVKVQQLKVHTEGGVVTTAET 355
gi 500032900 266 AELLAGLDVTRKRFAETEARFRKEVMEKYVESEQRVIDIEQELTKAARRNQLQVLRSPIDGVVQNLVIHTVGGVVQPAQE 345
gi 500033823 240 TGQQSKLRQIENGIQTLENRFVEQAKTEADKARQTLSELSHRLRKFDDRAARTILRAPANGVVKAILNNTVGGVVGAGET 319
gi 499221353 234 SKAVQGASDTQLKVRQIKQEFFEQVSQSITETRVRLAEVTEKEVVASDAQKRIKIVSPVNGTAQNLRFFTEGAVVRAAEP 313
gi 500031693 252 EVTKLELDEKWQNLRETEDSFYQDAMRELDGAYSELTQIRTTLPRLRDRMTRLVVRSPVDGVIKEIKVNGVGSVLGPGGE 331
gi 499386378 239 QVLARDIENLQRQLEQKQATLLKEVGEARTDAQAELLGITARLKSSDSQVQQNTITSPVDGIIQSIPNTSSGSVIQPGGT 318
gi 499283050 237 AQARGKSSEIDLQILQLDEDRRSEISKELTDVEAKIAEYEERRTAATDQLRRLDITAPLSGRIYQLAIHTVNGVINPGET 316
gi 499386511 257 PKLKAALDEAILKRREAVFVYAADLRAQLNETQTRLSRMNEAQVGAQDKVSKAIITSPVNGTIKTVHINTLGGVVQPGVD 336
gi 499272914 245 KESYTQIDRYRQEAVIAVNTNKQAALDGLEAAEADLDGVREQVREASEVLGRATIRSPVDGTVVRSYFHTAGGVIASGKP 324
gi 575874637 510 GSTRRQILELRLRMAQRREKFQEEVRASLADAQVRAEELRNRLASARFDLANSEVRAPVAGLVVGQEVFTEGGVIAPGQQ 589
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123210    356 LMVIVPEDDTLEVTALVQNKDIGFINVGQNAIIKVEAFPYTRYGYLVGKVKNINLDAIEDQRL-G---LVFNVIISIEEN 431
gi 500032900 346 LMRIVPTSGGIEVEAYLANKDIGFVEEGQAVEIKLETFPFTRYGLINGIVKKLSADAVEHEEM-G---LVYAARISMMKN 421
gi 500033823 320 VMDIVPMDDRLIVEGHLSPGDVGHVQIGQKGYITLASREGVRYGRLNAEVVHISPDTFTNERNqQ---TYYKVRMQTEGS 396
gi 499221353 314 LVDIAPEDEAFVIQAHFQPTDVDNVHMGMVTEVRLPAFHSREIPILNGTIQSLSQDRISDPQNkL---DYFLGIVRVDVK 390
gi 500031693 332 IAEIVPLEDTNKVEVKITTVDIGHVAVGQDVTVKVSTYDYARYGGIQGKLIAVSPSTFVDENGkD---PYYRGTIQLDQN 408
gi 499386378 319 VAVIVPTTPTALLEAKLSPRDIGFVSVGQKARIKIDAFDYSRYGALDGIVKRISPSTDADEKg-G---VFYKVQISIDKP 394
gi 499283050 317 LMLVVPEAEDLTVEAKVATHDIDQIRVGQSVEIRFSAFNQRTTPEVEAEVVTVAPDLVTDERTgA---SYYPLRIRPKAE 393
gi 499386511 337 IIEIVPSEDQLLIETKILPKDIAFLHTGLPAVVKVTAYDFTRYGGLKGTVEHISADTSQDEEg-N---SFYLIKVRTEES 412
gi 499272914 325 IMEILPANVPLIIEAQLLRTAIDQLKVGEDATIRLSALNRRTTPVLKGKVFYVSADSIEEEVAgGqqrDVYIVRVEVPAS 404
gi 575874637 590 LMEILPERQPLLVDARLPVEMVDKVRVGLPVELMFSAFNQSTTPRVEGEVTLVSADRLLDERSeA---PYYRVRIRVGEE 666
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*...
gi 123210    432 CLS-TGNKNIPLSSGMAVTAEIKTGMRSVISYLLSPLEESVTESLRER 478
gi 500032900 422 TMQ-VGERLVNITPGMSVTAEIKTGKRRIIEFFLSPIQKSMQEGLRER 468
gi 500033823 397 TFV-QGKYRYELYPGVQVTAAIRTSERRVIDYFLEPLMLGQSRALRER 443
gi 499221353 391 QLP--PHLRGRVTAGMPAQVIVPTGERTVLQYLFSPLRDTLRTTMREE 436
gi 500031693 409 YVG-SDPTKNLLLPGMTVEASIHTGSKTLMEYLLKPIYASVNDSFRER 455
gi 499386378 395 YFG-DQPDKLELIPGMTGEADIVTGDKTVFQYLWKPVFTNVTEAFGER 441
gi 499283050 394 SL--AKLKGLSLYPGMPAEVFIKIADRTVISYLTKPLTDQMRHAFRED 439
gi 499386511 413 SLIkDDGTQMPIIPGMLTTVDVITGQRSILEYILNPILRAKDTALRER 460
gi 499272914 405 EIG--RIHGFHPVPGMPAEVLITTSERTFFEYLTKPITDSMSRAFKET 450
gi 575874637 667 GV--RRLAGLEIRPGMPVEAFVRSGERSLLNYLFKPLADRTHLALGEE 712
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap