1GVF


Conserved Protein Domain Family
tag_bisphos_ald

?
TIGR01858: tag_bisphos_ald 
Click on image for an interactive view with Cn3D
class II aldolase, tagatose bisphosphate family
This model describes tagatose-1,6-bisphosphate aldolases, and perhaps other closely related class II aldolases. This tetrameric, Zn2+-dependent enzyme is related to the class II fructose bisphosphate aldolase; fructose 1,6-bisphosphate and tagatose 1,6 bisphosphate differ only in chirality at C4.
Statistics
?
PSSM-Id: 130917
View PSSM: TIGR01858
Aligned: 5 rows
Threshold Bit Score: 529.815
Threshold Setting Gi: 18311608
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GVF_A         3 IISTKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLD 82
gi 13638197    3 VVSTKQMLNNAQRGGYAVPAFNIHNLETMQVVVETAANLHAPVIIAGTPGTFTHAGTENLLALVSAMAKQYHHPLAIHLD 82
gi 488138680   3 LVSSREMLRQAQIGGYAIPAFNIHNLETIQAVVETAAEMASPVILAGTPSTFSYAGTEYLVQICQQAARHYRMPFALHLD 82
gi 1168381     3 IISTKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLD 82
gi 499320506   4 IKSTKDMLLRAQKGGYAIPAFNIHNLETFQVVVETAAELNSPVIIAGTPGTIDYAGPDYIVAMAEVASQKYDIPIAIHLD 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GVF_A        83 HHESLDDIRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGGVEDDMSVDAESAFLTDPQEAKR 162
gi 13638197   83 HHTKFDDIAQKVRSGVRSVMIDASHLPFAQNISRVKEVVDFCHRFDVSVEAELGQLGGQEDDVQVNEADALYTNPAQARE 162
gi 488138680  83 HHESYDDITQKVAAGIKSIMIDGSHFNFEQNIALTRQVVEYCHRWDGTVEAELGRLGGQEDDLTVDEKDALYTDPGSAAH 162
gi 1168381    83 HHESLDDIRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGGVEDDMSVDAESAFLTDPQEAKR 162
gi 499320506  84 HFEDPKLIKSHIITGFKSCMIDASHLSFEDNVNMVKEVVDFAHRYDATVEAELGKLVGVEDDLVVDENEGAYTDPDAALE 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GVF_A       163 FVELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTIELGVTKVNVATELKIAFAGA 242
gi 13638197  163 FAEATGIDSLAVAIGTAHGMYASAPALDFSRLENIRQWVNLPLVLHGASGLSTKDIQQTIKLGICKINVATELKNAFSQA 242
gi 488138680 163 FIQATGIDSLAIAIGTAHGMYKEAPSLDFDRLALIRRNTDIPLVLHGGSGIPDEDVRRCIELGISKVNVGTELKIAFSGA 242
gi 1168381   163 FVELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTIELGVTKVNVATELKIAFAGA 242
gi 499320506 164 FVERTGVDSLAIAIGTAHGLYKGTPKLDFDRLVKIREKVSVPLVLHGASDVPDELVKKAIELGICKVNVATDLKIPFSDA 243
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
1GVF_A       243 VKAWFAENPQGNDPRYYMRVGMDAMKEVVRNKINVCGSANRI 284
gi 13638197  243 LKNYLTEHPEATDPRDYLQSAKSAMRDVVSKVIADCGCEGRA 284
gi 488138680 243 LKAYFLENKGANDPRHYMVPAKAAMKKVIQDKINVCGSAGKR 284
gi 1168381   243 VKAWFAENPQGNDPRYYMRVGMDAMKEVVRNKINVCGSANRI 284
gi 499320506 244 VKDYFIANPKANDPRKYMTPGKEAMKKIVEHKILLCGSNGKA 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap