Conserved Protein Domain Family
VNFD

?
TIGR01860: VNFD 
nitrogenase vanadium-iron protein, alpha chain
This model represents the alpha chain of the vanadium-containing component of the vanadium-iron nitrogenase compound I. The complex also includes a second alpha chain, two beta chains and two delta chains. Compount I interacts with compound II also known as the iron-protein which transfers electrons to compound I where the catalysis occurs. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 130919
View PSSM: TIGR01860
Aligned: 3 rows
Threshold Bit Score: 1029.9
Threshold Setting Gi: 138886
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416166      2 PLKLLKCDETIPEREKHVYIKEKGEDTTQFLPLSNIETIPGSLSERGCSYCGAKLVIGGVLKDTIQMIHGPIGCAYDTWH 81
gi 138886      2 PMVLLECDKDIPERQKHIYLKAPNEDTREFLPIANAATIPGTLSERGCAFCGAKLVIGGVLKDTIQMIHGPLGCAYDTWH 81
gi 499330745   2 PLKLFCCDECIPERKNHVYIKEEGEDTTDFLPLSNIDTIAGSLSERGCSYCGAKLVIGGVIKDCIQMIHGPVGCAYDTWH 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416166     82 TKRYPSDNGNFQLKYVWSSDMKESHVVFGGEKQLGKSIREAFKEFPDIKRMIVYTTCATALIGDDIKAVVKSAQQELGDV 161
gi 138886     82 TKRYPTDNGHFNMKYVWSTDMKESHVVFGGEKRLEKSMHEAFDEMPDIKRMIVYTTCPTALIGDDIKAVAKKVMKDRPDV 161
gi 499330745  82 TKRYPSDNDNFQLKYIWSSDTKEKHIVFGAEKQLKKAIMEAFQEFPAIKRMFVYTTCTTALIGDNPKAVCREVQEELEDV 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416166    162 DIFCVECPGFAGVSQSKGHHVLNIAWINEKVGTLEPEITSPYTINVIGDYNIQGDTFVLEKYMEKMGIQIIAHFTGNGTY 241
gi 138886    162 DVFTVECPGFSGVSQSKGHHVLNIGWINEKVETMEKEITSEYTMNFIGDFNIQGDTQLLQTYWDRLGIQVVAHFTGNGTY 241
gi 499330745 162 DIFVVECPGFAGVSQSKGHHELNIGWMRDKIGTLEPEITSEYTINVIGDYNIQGDTYVLQKYLDKMGIQVIAHFTGNVTY 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416166    242 DSLRGMHRAQLNVTNCARSAGYIANELKKRYGIPRLDVDTWGFDYCQEALRKIGAFFGIEDRAEAVIAEEIAKYQEKMDW 321
gi 138886    242 DDLRCMHQAQLNVVNCARSSGYIANELKKRYGIPRLDIDSWGFNYMAEGIRKICAFFGIEEKGEELIAEEYAKWKPKLDW 321
gi 499330745 242 DQLRCMHRAKLNVVNCARSAGYIANELKRVYDIPRMDVDTWGFEYVKVALRKIGAFFGLEDKAEEVIAEEVAKYEGKLDW 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416166    322 YKERLSGKKVCIWTGGPRLWHWTKALEDDLGMQVVSMSSKFGHQEDFEKVIARGQEGTIYIDDGNELEFFEVLEMIRPDV 401
gi 138886    322 YKERLQGKKMAIWTGGPRLWHWTKSVEDDLGVQVVAMSSKFGHEEDFEKVIARGKEGTYYIDDGNELEFFEIIDLVKPDV 401
gi 499330745 322 YKERLKGKQICIWTGGPRLWHWTKALEDDLGMEVVAMSSKFGHQEDFEKVIARGRIGTIYIDDGNELEFFEVLDNIHADL 401
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 416166    402 VLTGPRVGALVKKLHLPYVNGHGYHNGPYMGFEGAVNMARDLYNAIYSPLMQLAAIDVRDD 462
gi 138886    402 IFTGPRVGELVKKLHIPYVNGHGYHNGPYMGFEGFVNLARDMYNAVHNPLRHLAAVDIRDK 462
gi 499330745 402 IFTGPRVGDLVKKLHIPYINGHAYHNGPYMGFEGAVNMARDMYNAIYSPMWKLAGKDPRET 462
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap