Conserved Protein Domain Family
peptidase-T

?
TIGR01882: peptidase-T 
peptidase T
This model represents a tripeptide aminopeptidase known as Peptidase T, which has a substrate preference for hydrophobic peptides. [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 130937
View PSSM: TIGR01882
Aligned: 3 rows
Threshold Bit Score: 734.394
Threshold Setting Gi: 1709639
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172068     2 KyEKLLPRFLEYVKVNTRSDENSTTTPSTQALVEFAH-KMGEDMKALGLKDVHYLEsNGYVIGTIPANTDKKVRKIGLLA 80
gi 1709639     2 K-EEIIERFTTYVKVDTQSDESVDTCPSTPGQLTLGN-MLVDELKSIGMQDAAIDE-NGYVMATLPSNTEKDVPTIGFLA 78
gi 143811437   2 EyPNLLPRFLKYVKVNSRSDENSDRFPSTEREENFQKnVIMKDLEELGLSDIHYNQkAGSVIAEIPSNVDYDVPVMGFLA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172068    81 HLDTA-DFNAEGVNPQILENYDGESVIQLGDTEFTLDPKDFPNLKNYKGQTLVHTDGTTLLGSDDKSGVAEIMTLADYLL 159
gi 1709639    79 HVDTAtDFTGKNVNPQIIESYDGKDIVLNEQLQVTLSPDQFPELSGYKGHTLITTDGTTLLGADNKAGIAEIMTAMDYLI 158
gi 143811437  82 HSDTA-DFNSENVKPQIHKNYDGESKIQLGDSEFYLDPEVYPNLRKYKGQTIITASGDTLLGADDKCGISELMTFAEYLM 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172068   160 NiNPDFEHGEIRVGFGPDEEIGVGADKFDVADFDVDFAYTVDGGPLGELQYETFSAAGAVIEFQGKNVHPGTAKNMMVNA 239
gi 1709639   159 K-HPEIKHGTIRVAFTPDEEIGRGPHKFDVKRFNASFAYTVDGGPLGELEYESFNAAAAKITIKGNNVHPGTAKGKMINS 237
gi 143811437 161 N-HPEVKHGKIRLAFTPDEEIGTGAEQFDVKDFGADFAFTVDGEAPGKLGDCTFSAAQFTLDIQGVNVHPAVAKGQMINA 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172068   240 LQLAIDYHNALPEFDRPEKTEGREGFFHLLKLDGTPEEARAQYIIRDHEEGKFNERKALMQEIADKMNAELGQNRVKPVI 319
gi 1709639   238 AKIAMKLNSLLPADEAPEYTEGYEGFYHLLSIQGDVEETKLHYIIRDFDKENFQNRKETMKRAVEELQNEYGQDRILLDM 317
gi 143811437 240 VQVGIDFHNQLPEHDRPEHTDGREGFFHLLSFDGTVDHAHLAYIIRDFERDGLEERKNLVKSIVKKMNDEFGTERIKLQM 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172068   320 KDQYYNMAQIIEKDMSIIDIAKKAMENLDIAPIIEPIRGGTDGSKISFMGLPTPNLFAGGENMHGRFEFVSVQTMEKAVD 399
gi 1709639   318 NDQYYNMREKIEPVIEIVNIAKQAMENLGIEPKISPIRGGTDGSQLSYMGLPTPNIFTGGENFHGKFEYISVDNMVKAVN 397
gi 143811437 320 NDQYYNMADELKKHMDIVDLARDAYKAEGLEVNEDPVRGGTDGSQLTYMGLPCPNIFAGEENMHGRYEYTVLESMYKTVD 399
                        410
                 ....*....|...
gi 1172068   400 TLLEIIRLNNEVA 412
gi 1709639   398 VIVEIAKQFEAQA 410
gi 143811437 400 VMIKMAELNAERA 412
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap