1FZP,1HSJ


Conserved Protein Domain Family
Staph_reg_Sar

?
TIGR01889: Staph_reg_Sar 
Click on image for an interactive view with Cn3D
staphylococcal accessory regulator family
This model represents a family of transcriptional regulatory proteins in Staphylococcus aureus and Staphylococcus epidermidis. Some members contain two tandem copies of this region. This family is related to the MarR transcriptional regulator family described by pfam01047. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130944
View PSSM: TIGR01889
Aligned: 13 rows
Threshold Bit Score: 82.3023
Threshold Setting Gi: 27316336
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FZP_B         9 FELLSMVTYADKLKSLIKKEFSISFEEFAVLTYIS--ENKE---KEYYLKDIINHLNYK-QPQVVKAVKILSQEDYFDKK 82
gi 13702449  135 KEFFILFMNIMYSKDFLKYRFNLTFLDLSILYVIS--SRKN---EILNLKDLFESIRFM-YPQIVRSVNRLNNKGMLIKE 208
1HSJ_A       380 NDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILrsESNE-----ISSKEIAKCSEFK-PYYLTKALQKLKDLKLLSKK 453
gi 27316336  128 STLLSYYLKCHSQFRVIEQSCTSQHLTLEELYLLGllIISD---NKTTFKSIKVHALKG-IIAMGPIIKTLQSKGYLIKS 203
gi 27316306    6 QRFIESERELSQLKHWLKTTYRISIEEFVVLYKVYadTKIS---GKELRDTLHFEMLWD-TSKIDVIIRKIYKKELISKL 81
gi 667464004  50 CDYVSYLLSSQELLRNLKCYLNMCQLSLEELYVLGilNLHK---GQLTVKELQGEFHHP-IFAVSPILKCLILKGLVKKE 125
gi 578667394  29 KEFLNLMMYTMYFKNIIKKHLTLSFVEFTILAIIT--SQNK---NIVLLKDLIETIHHK-YPQTVRALNNLKKQGYLIKE 102
gi 487705882  11 IKLMKRVLTTYELRKYLKKYFCLTLDNYLVLAYLDvfKNDE---GKYFMRDIISYIGID-QSRIVKSVKDLSKKGYLNKC 86
gi 445954997   7 KRLTAHILMLKVINDMLKYSFHLTLTQVKLLNLLVkyDNSDs--NSASIDSLLKMKEIQsKMALLQMLSYLNNHQWLLKG 84
gi 487717020  18 RDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLf--HQQE---NTLPFKKIVSDLCYK-QSDLVQHIKVLVKHSYISKV 91
gi 558555842  21 NKFINVKAYIFFLTQELKQQYKLSLKELLILAYFY--YKNE---HSISLKEIIGDILYK-QSDVVKNIKSLSKKGFINKS 94
gi 394330351  21 ETLLGFYKQYKALSEYIDKKYKLSLNDLAVLDLTMkhCKDEkvlMQSFLKTAMDELDLS-RTKLLVSIRRLIEKERLSKV 99
gi 488434253  13 lQLETLFKEIDSIFNTIKEEYGMSKEEILI----LltLLEK---GSMTLKEMDKYVHIK-PYKRTRTYNNLVNLEWIYKE 84
                         90       100       110
                 ....*....|....*....|....*....|...
1FZP_B        83 RNEHDERTVLILVNAQQRKKIESLLSRVNKRIT 115
gi 13702449  209 RSLADERIVLIKINKIQYNTIKSIFTDTSKILK 241
1HSJ_A       454 RSLQDERTVIVYVTDTQKANIQKLISELEEYIK 486
gi 27316336  204 RSRDDERYIVLTLRKEKVNVIQSEIEECYNKLE 236
gi 27316306   82 RSETDERQVYYFFDAKQKKLLDKMTGEIETISI 114
gi 667464004 126 RCELDERRVIVTIKREKFSKVTMLIQACYNYLE 158
gi 578667394 103 RSTEDERKILIHMDDAQQDHAEQLLAQVNQLLa 135
gi 487705882  87 RDPHDSRNVIIVVSVKQHNYIKNLLSEININET 119
gi 445954997  85 RDQRDQRKLTISINKMHIDKIEYMNNELSDYIE 117
gi 487717020  92 RSKIDERNTYISISEEQREKIAERVTLFDQIIK 124
gi 558555842  95 RNEADERRIFVSVTPIQRKKIACVINELDKIIK 127
gi 394330351 100 RSSKDERKIYIYLNNDDISKFNALFEDVEQFLN 132
gi 488434253  85 RPQDDERTVIIHFNDKQNSKKEDLLKFIDDSIK 117
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap