Conserved Protein Domain Family
AcOrn-deacetyl

?
TIGR01892: AcOrn-deacetyl 
acetylornithine deacetylase (ArgE)
This model represents a clade of acetylornithine deacetylases from proteobacteria. This enzyme is the final step of the "acetylated" ornithine biosynthesis pathway. The enzyme is closely related to dapE, succinyl-diaminopimelate desuccinylase, and outside of this clade annotation is very inaccurate as to which function should be ascribed to genes. [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 130947
View PSSM: TIGR01892
Aligned: 4 rows
Threshold Bit Score: 556.742
Threshold Setting Gi: 3044087
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114142     10 EIYRALIATPSISATeealdqSNADLITLLADWFKDLGFNVEVQPVPGTr--NKFNMLASIGq---gAGGLLLAGHTDTV 84
gi 3044087    10 ATLTELVAMDTTSFR------PNVPLIDYAQARLEAAGFSAERQKFLDDagvEKVNLVAVKGgsgsgRAALALVGHSDCV 83
gi 499270577   5 EILGKLVGFRSVVGL------PNNDVVSWIRGYLESHGIAVDVLPGPEG---DRSNIFATIGpk--eARGYIISGHMDVV 73
gi 499223918  14 DILAKLVAFDTTSRR------SNLALIEWVEQYLAELNVPTRRVPNADG---TKSNLMAMIGpa--vEGGVVLSGHTDVV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114142     85 PFDdGRWTrDPFTLTEHDGKLYGLGTADMKGFFAFILDALrdVDVTKLKKPLYILATADEETSMAGARYFAETTA---LR 161
gi 3044087    84 PYD-AAWT-DALRLTEKDGRLYARGACDTKGFIACALHAA--LNAEQLKAPLMVVLTADEEVGLTGAKKLVEAGL---GR 156
gi 499270577  74 PAAeTGWTsDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVpkLAAMPLRRPLHLALSYDEEAGCRGVPHMIARLPelcRQ 153
gi 499223918  83 PVDgQPWStDPWTLTERDGRLYGRGTCDMKGFLALALAAApdLAQANLRKPVHLAFSYDEEVGCLGAPDMIDVIArevPR 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114142    162 PDCAIIGEPTSLQPVRAHKGHISNAIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKER-YHYEAFTVPYPTLN 240
gi 3044087   157 ARHAIVGEPTRLIPVRANKGYCLAEVEVRGKEGHSAYPDSGASAIFRAGRFLQRLEHLALTVLRE-DLDEGFQPPFTTVN 235
gi 499270577 154 PLGAIIGEPTGMRAIRAHKGKAAARLTVRGRSGHSSRPDQGLNAIHGVAGVLTQAVAEADRLVGG-PFEHVFEPPYSSLQ 232
gi 499223918 163 PALVVVGEPTDMVAVRAHKGIASFKVTVTGREAHSSLTHLGVSANMVAIKLMAMLVGLSEKLEREaDPNSPFTPKGATLT 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114142    241 LGHIHGGDASNRICACCELHMDIRPLPGMTLNELNGLLNDALAp----VSERWPGRLTVDELHPPIPGYECPPNHQLVEV 316
gi 3044087   236 VGVIQGGKAKNVIPGACRFVVEWRPIPGQPPERVSQLLETIRQe----LVRDEPAFEAQIRVVRTDRGVNTRADAEVVRF 311
gi 499270577 233 IGTVKGGQAVNIIPDSCEVEFEARAISGVDPAELLAPVRKTAEa----L--TTLGFEVEWQELSAYPALSLEPDAPLAAL 306
gi 499223918 243 IGQVNGGTAVNILARECVFIFDLRTPAGMDPVALLSDFFAMASaldaqIKAKAPEGGVKVERRSLTPAFAPEEDGVAEAF 322
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 114142    317 VEKLLGA--KTEVVNYCTEAPFIQTL-CPTLVLGPGSINQAHQPDEYLETRFIKPTRELITQVI 377
gi 3044087   312 LAEASGN--APETVSFGTEAPQMTELgAEAVVFGPGDIRVAHQTGEYVPVEDLVRCEAVLARAV 373
gi 499270577 307 LEELTGRe-ALPAVSYGTEAGLFQRAgIDAIICGPGDIGRAHKPDEYILIDELMACRAMVEALG 369
gi 499223918 323 ARKLAGDngPARVVPYAAEAGQFQGAgFSTVICGPGSIDQAHQPNEYVEISQMQRGGAFMRRLV 386
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap