Conserved Protein Domain Family
dapE-lys-deAc

?
TIGR01902: dapE-lys-deAc 
N-acetyl-ornithine/N-acetyl-lysine deacetylase
This clade of mainly archaeal and related bacterial species contains two characterized enzymes, an deacetylase with specificity for both N-acetyl-ornithine and N-acetyl-lysine from Thermus, which is found within a lysine biosynthesis operon, and a fusion protein with acetyl-glutamate kinase (an enzyme of ornithine biosynthesis) from Lactobacillus. It is possible that all of the sequences within this clade have dual specificity, or that a mix of specificities have evolved within this clade.
Statistics
?
PSSM-Id: 130957
View PSSM: TIGR01902
Aligned: 4 rows
Threshold Bit Score: 506.699
Threshold Setting Gi: 15897112
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18143379   10 EFLKGALEIPSPSGKERLVAEYLAEGMQKLgLKG-FVDEADNARGQVGEGPVQVVLLGHIDTVPGQIPVRLEGGRLFGRG 88
gi 28270214  272 QLFTNIVTIPSVSFDEHVLANYLNDLKMAN-ITS-NIDSAGNIVLKKGSGHKKLLLLGHIDTVRNFWQVKIEAGSLKGRG 349
gi 499169291  10 KFLKELVEIYSPTGKEEEAAKFIKEKLEEYgVKA-YIDKVGNVIGVKEGEGPLILLAGHVDTVPGYIPVRIEGDILWGRG 88
gi 497676202  14 ELLLDLLSIYTPSKSEANATKFFEKISKDLnLKLeILPDSNSFILGEGD----ILLASHVDTVYGYIEPKIENELIYGRG 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18143379   89 AVDAKGPFVAMIFAAAglSeeaRKRLTVHLVGATEEEApSSKGARFVAPRLKPH-YAVIGEPSGWEGITLGYKGRLLVKA 167
gi 28270214  350 AVDAKAPFATFLSVLN--KvkvPSDCQLIVIGAVEEESsSSKGAYQVRDNYEKM-PVIIGEPSGIEKLTLGYNGLLKLKL 426
gi 499169291  89 SVDAKGPLSALLFAMV------ESNANVIFAGLVDEEG-FSKGAR-ALDVPRPE-YVIVGEPSGVNGVTIGYKGSLTVRF 159
gi 497676202  90 AVDAKGPLISMIIATWllN---EKGIKVRVSGLADEES-TSIGAKELIAKNYNFkYIIVGEPSNATDIVVEYRGSIQLDI 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18143379  168 RREKDHFHSAHHEPn-AAEELISYFVAIK-AWAEAMNvgqrpFdQVQYTLRDFRVHPAELRQVAEMFFDLRLPPRLPPEE 245
gi 28270214  427 NCHMVQGHSAGKGAisSIDALIDYSNKIR-EIMANYD-----P-KGLSSIQDISHSKSDNQTELLLNFRVSRYVKSGYVE 499
gi 499169291 160 VERVEKFHGSIGGG--AAEKLIERWLSISgNFEDGFN-------GLSGRIVRFVAYERDFEFYGEMIVNLRTPPGYEP-- 228
gi 497676202 166 MCEGTPEHSSSAKN----NLIVDISKKIIeVYKQPENy---dKpSIVPTIIRAGESYNVTPAKLYLHLDIRYAINNKRED 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18143379  246 AIRHLTayaPPTIE-LEFFGREVPYQGPKDTPLTRAFRQAIRKAG-GRPVFKLKTGTSDMNVLAPHWPVPMVAYGPGDST 323
gi 28270214  500 AIKKQT---DKNIS-LEVLRDTPASTSKRSNQLANAFVSGFKVVQkMIPEYIVKTGTSDMNTLATQWTVPMVAYGPGDST 575
gi 499169291 229 -PRDWD-----------IIDFVPAYEVNRRSPLVRTFVRSIRELG-MKPKLKKKSGTADMNILAPRFGVDAVAYGPGDSR 295
gi 497676202 239 LIKEITd--KFPECnLKIVDETPPVKVSINNPVVKSLARALLKQN-IKPRLVKKAGTSDMNILQRI-TTNIATYGPGNSM 314
                        330       340       350
                 ....*....|....*....|....*....|.
gi 18143379  324 LDHTPYEHVEVAEFLKGIEVLRGALEALAQT 354
gi 28270214  576 LDHTLQEEVPFADYHLGIQTLQEAIQTYLGK 606
gi 499169291 296 LDHTPYERISLMEYLQSIDVLKNVLTKLKGK 326
gi 497676202 315 LEHTTQEKISLDEIYIGVKTYMLAIEELWQK 345
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap