Conserved Protein Domain Family
various_sel_PB

?
TIGR01918: various_sel_PB 
selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family
This model represents selenoprotein B of glycine reductase, sarcosine reductase, betaine reductase, D-proline reductase, and perhaps others. This model is built in fragment mode to assist in recognizing fragmentary translations. All members are expected to contain an internal TGA codon, encoding selenocysteine, which may be misinterpreted as a stop codon.
Statistics
?
PSSM-Id: 130973
View PSSM: TIGR01918
Aligned: 3 rows
Threshold Bit Score: 799.127
Threshold Setting Gi: 3097061
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11065689   5 KVVHYLNQFFAGIGGEEKADTLPHIAESQPPISQQLQKLIEEDAEIVGVVVCGDSYFNENLEEAKAKVLEMIKSFNPDIL 84
gi 14717791   5 RVVHYINQFFAGIGGEEKADIAPFVAEELPPISQNLDKLLGEDAEVVATVVCGDSFFGENLETAQATVLEMVKGASPDLF 84
gi 3097061    3 KAILYLNQFFGQVGGEDKADYEPEIINGQVGAAMMLNGVLEG-AEVTHTIICGDNFMGTYKDEAVSRIMGFLEDKEFDIF 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11065689  85 IAGPAFNAGRYGMACGTVVKMVQDELNLKAFTAMYEENPGLDVFRKEVYVIPTSDSAAGMRKALPAVAKFATKLAKGEEI 164
gi 14717791  85 IAGPAFNAGRYGVAAGAITKAVQDTLGIPAVTGMYIENPGADMYKKSVYVMSTADSAAGMRKSLPALAKFALKYAKGEEI 164
gi 3097061   82 LAGPAFQAGRYGVACGEICKVVKEKYNVPVVTSMHVENPGVQMFKKDMYVMIGGNNAGRMRQDMSAMAKVANKIIAGEKI 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11065689 165 LSPQEDGYFARGVRVNAFVDER--GSMRAVKMLVKKLKGEEFETEYPMPVFDRVAPNPAVKDITKAKIALVTSGGIVPKH 242
gi 14717791 165 GSPAEEGYIERGIRVNGFKEDR--GAKRAVAMLVKKLKGEEFVTEYPMPVFDNVVPGRAIVNMSKAKIAIVTSGGIVPKG 242
gi 3097061  162 GPADEEGFFPRGKRHQHWREDGkpASERVVDMLLKKLSGEEFQTELPIPKSDRVEIAAPIKDLSKATIAVVTTGGIVPVD 241
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11065689 243 NPDHIESSSASKYGRYDISSFDKLSEADHETAHGGYDPTYANNEPDRVLPVDVLRDLEKEGKIGELFKYFYTTVGNGTSV 322
gi 14717791 243 NPDRIESSSASKYGKYDIDGVDDLTSEGWETAHGGHDPVYANEDADRVIPVDVLRDMEKEGVIGELHRYFYSTTGNGTAV 322
gi 3097061  242 NPDRIQSASATRWGMYDVTGLERLEGGVYKTIHAGFDPAAADADPNVIVPLDALRAYEKEGKIGKVHEYFYSTVGTGTTE 321
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11065689 323 ANSKQFAQEFSKELLENKVDAVILTSTUGTCTRCGATMVKEIERAGIPVVHMCTVVPISLTVGANRIIPTIAIPHPLGNP 402
gi 14717791 323 LSSKQFAKEFTQELMAAGVDAVILTSTUGTCTRCGATMVKEIERSGIPVVHICTVTPIALTVGANRIVPAIAIPHPLGDP 402
gi 3097061  322 AEAARMAKEIVVKLKQGGVDGVIMTSTXGTCTRCGATMVKEIERAGFPIVQMCNLIPVASTVGANKIVPTISIPYPLGDP 401
                       410       420       430
                ....*....|....*....|....*....|...
gi 11065689 403 ALDAAEEKQLRRKLVEKALKALETEVEDQTVFE 435
gi 14717791 403 ALSPAEEKALRRKIVEKSLKALETEIEEQTVFE 435
gi 3097061  402 STSKEQQWKLRYHRVGTALDALTVDVQEQTIFK 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap