Conserved Protein Domain Family
spIIAB

?
TIGR01925: spIIAB 
anti-sigma F factor
This model describes the SpoIIAB anti-sigma F factor. Sigma F regulates spore development in B subtilis. SpoIIAB binds to sigma F, preventing formation of the transcription complex at the promoter. SpoIIAA (anti-anti-sigma F factor) binds to SpoIIAB to inhibit association with sigma F, however SpoIIAB can phosphorylate SpoIIAA, causing disassociation of the SpoIIAA/B complex. The SpoIIE phosphatase dephosphorylates SpoIIAA. [Regulatory functions, Protein interactions, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 130980
View PSSM: TIGR01925
Aligned: 3 rows
Threshold Bit Score: 222.106
Threshold Setting Gi: 15895574
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134758      1 MKNEMHLEFSALSQNESFARVTVASFIAQLDPTMDELTEIKTVVSEAVTNAIIHGYEENCEGKVYISVTLEDHVVYMTIR 80
gi 489546758   1 MDNKMRLEFLAKSENEGFARVSVSAFIAQLDPTIEELTDIKTAVSEAVTNAIIHGYECDESKVVIIEASICEDEISITVE 80
gi 499268211   2 LENKMELKFLAKSENESFARVTVASFASELDPTLEEIDDVKMAVSEAVTNAIIHGYE-NKGGVVTICAVIEDRELTIEVM 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 134758     81 DEGLGITDLEEARQPLFTTKPELERSGMGFTIMENFMDDVSIDSSPEMGTTIRLTKH 137
gi 489546758  81 DNGIGIENLEEAREPLYTSKPELERSGMGFTVMETFMDSLEVYSEKDKGTKIIMKKK 137
gi 499268211  81 DEGIGIENIEKAMEPLYTSRPDLERSGMGFTVMESFMDNIKVESEKGKGTKIIMKKK 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap