3C1L


Conserved Protein Domain Family
peroxid_rel

?
TIGR01926: peroxid_rel 
Click on image for an interactive view with Cn3D
uncharacterized peroxidase-related enzyme
This protein family with length of about 200 amino acids. One member, from Myxococcus xanthus, is a selenoprotein, with an otherwise conserved Cys replaced by Sec. This family is drawn narrowly enough to suggest that These proteins contain a domain described by TIGR00778, with a CxxCxxxHxxxxxxxG motif. Some members of that family are known to act as peroxidases or correlate with resistance to oxidative stress.
Statistics
?
PSSM-Id: 130981
View PSSM: TIGR01926
Aligned: 8 rows
Threshold Bit Score: 235.382
Threshold Setting Gi: 167013506
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C1L_A         7 SALDLAS-GELSEPTKAYFAKCEEKLGLVPNVLKAYAFDDKKLRAFTDIYNDLXLGESG--LSKLDREXIAVAVSSINHC 83
gi 499311352  13 SRFPVPElADIPGDIRERILAVQEKTGFVPNVFLALAHRPDECRAFFAYHDALMLREAGs-LTKGEREMIVVATSAANQC 91
gi 499190860  37 SFLAVPTeDNAHEGVKKLWSKAEANMGFVPNVFRAQALNGEQFLAWWNYFNLLVNKEGG--LSNAERELLAVVVSGLNRC 114
gi 499281614  17 PYVKPVDlATATPEQLSALKVTPSNTK-VSAYVLVLANEAEALNERTPLFNDIMYSDGG--LSRGGREIGALAASFVNHC 93
gi 499214646   6 SALDLAS-GELSEPTKAYFAKCEEKLGLVPNVLKAYAFDDKKLRAFTDIYNDLMLGESG--LSKLDREMIAVAVSSINHC 82
gi 499311050  19 AWLDVVDlDRATPGQIAVLEESHPKAK-TSDYYRFLVHQPEILRQRSAAFNAIMYAPGG--LSRAERELASTVVSRVNGC 95
gi 499324625 233 PWVPPVAkADLTEEQLDSL--IQPERA-DMPYFRLLARDPAALKARTLTDLDIFFNTDGegLGRAERELGATVTSRYNGC 309
gi 501844027  25 SRLRVPTeDELPQKLRDIHMRIRKKFGFVPNFLTALSANPGTALRIMAFYEHLFDQSNSh-LSASERELIAVVTSVATGC 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C1L_A        84 YYCLTAHGAAVRQLSGDPALGEXLVXNFRAADLSPRQTAXLEFAVKLTEEPAKIVEADRAALRKAGFSDRDIWDIASTAA 163
gi 499311352  92 LYCVIAHGAILRIYEKQPLIADQVAVNYRKADITPRQRAMLDFAMQVCTASHTVNEADYDALHVHGFTDEDVWDIAGITA 171
gi 499190860 115 VYCAVSHGAALREFSGDAVKADAVAVNWRQAELSEREQAMCAYAEKLTLRPAEMTEADLAPLRAAGLSDEAILEAVQVIA 194
gi 499281614  94 IYCAAVHANRYIQLEKRPEVVDAIYKNGLDADLPDFEQALFNFGVDLTAHPDNVGVYQFYHLREIGLDDLEILDLIHSIA 173
gi 499214646  83 YYCLTAHGAAVRQLSGDPALGEMLVMNFRAADLSPRQTAMLEFAVKLTEEPAKIVEADRAALRKAGFSDRDIWDIASTAA 162
gi 499311050  96 VYCAAVHAQRFEQLAKRNDVIRQVFEDPHTAGTNARERAIARFSIDLTLRPGDVRAEDLQPLQAAGLTDAEILDLIHAVA 175
gi 499324625 310 VYCASVHAGRAQEESGRADDVNALLASIDSDLGSDQWNVIRDAARALSSTPAAFNQGCITKLRGVGFSDLQIVDLINSVA 389
gi 501844027 104 SYCVFNHRPALAAALGDRVLADRIARNHNDVTLAPRERALADLAQKLAATPHSVGSDDFARLRAIGFSEPAILEVLEVSA 183
                        170
                 ....*....|....*....
3C1L_A       164 FFNXSNRVAAAIDXRPNDE 182
gi 499311352 172 FFGLSNRIANVISMRPNDE 190
gi 499190860 195 MFNMTNRVSSALGFVPNPE 213
gi 499281614 174 IFGWANRLMHTLGEPHRKE 192
gi 499214646 163 FFNMSNRVAAAIDMRPNDE 181
gi 499311050 176 IFAWANRLMLNLGEPVFPD 194
gi 499324625 390 FFNWANRLMLSLGEPEVPK 408
gi 501844027 184 FFSYGNRLTIALNVLPDPQ 202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap