Conserved Protein Domain Family
hflK

?
TIGR01933: hflK 
HflK protein
HflK and HflC are paralogs encoded by tandem genes in Proteobacteria, spirochetes, and some other bacterial lineages. The HflKC complex is anchored in the membrane and exposed to the periplasm. The complex is not active as a protease, but rather binds to and appears to modulate the ATP-dependent protease FtsH. The overall function of HflKC is not fully described.//Regulation of FtsH by HflKC appears to be negative (SS 8/27/03]
Statistics
?
PSSM-Id: 130988
View PSSM: TIGR01933
Aligned: 8 rows
Threshold Bit Score: 375.201
Threshold Setting Gi: 6647518
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6647523    33 IRIISPTDNGVVTRFGKYHRTLEPGLHYLIPF-VEWVYKVPVTKVQkeefgfrtsksseqshyvnNISHESLMLTGDLNI 111
gi 1170267   104 FYTIKEAERGVVLRFGELHSIVQPGLNWKPTF-VDKVLPVNVEQVK-------------------ELRTQGAMLTQDENM 163
gi 25008546   88 FYTIKEAERGVVTTFGKFSHLVAPGLNWRPVF-INEVKAVNVETVR-------------------ELATSGVMLTSDENV 147
gi 123095     97 FYTIKEAERGVVTRFGKFSHLVEPGLNWKPTF-IDEVKPVNVEAVR-------------------ELAASGVMLTSDENV 156
gi 20138381   87 FYTIGEAERGVVLRLGKYDRIVDPGLNWRPRF-IDEVTPVNVQAIR-------------------SLRASGLMLTKDENV 146
gi 6647518    32 IFIVGPSEEAIVLRLGKLNRTLDSGIHVKIPL-IEEKFIVPVKIVQeikfgflis--psdirendNANDESRIITGDLNI 108
gi 499257942 100 VYVVDEQEQAVVLRFGKYYETVGPGLNIYFPP-IDRKYMENVTRER-------------------AYTKQGQMLTEDENI 159
gi 499195440  65 IQLIGEQQRGVVLRFGQFVRVLQPGLSLKLPWpVESVYKVNATEIK-------------------TFGKQVPVLTRDENI 125
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6647523   112 VDVEWVVQYRIVDPRAWVFNVESQErrQTIRDISKAVVNSLIGDRAILDIMGPERSAIQMRAKDMMNVLLKRIGLGVLVS 191
gi 1170267   164 VKVEMTVQYRVQDPAKYLFSVTNAD--DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVI 241
gi 25008546  148 VRVEMNVQYKITDPADYLFSVAYPD--DSLRQATDSALRGVIGHSNMDRVLTEGRTLIRSDTQKEIEETIKPYKLGITIL 225
gi 123095    157 VRVEMNVQYRVTNPEKYLYSVTSPD--DSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMGITLL 234
gi 20138381  147 VTVSMDVQYRIADPYKYLYRVTNAD--DSLRQATDSALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQVIDSYDMGLMIV 224
gi 6647518   109 INIEWLVQYKIRDPYSFKFKVEDPE--TTIKDIAKSSMNRLIGDNTIFEIINDNRVGITEGVKSSMNEIIDNYNLGIDVV 186
gi 499257942 160 VEVPLTVQYKISNLQDFVLNVDQPE--VSLQHATDSALRHVVGSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVT 237
gi 499195440 126 VNVTLNVQYQINDPHLYLYGSRNAN--EVLVQAAQSAVREQVGRSDLNSVLN-NRGPLSTASKERLQASLDAYRTGLLVT 202
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6647523   192 SVQLQNVVPPQ-EVQQAFEDVNIAIQDMNRLINEGKESYNREIPKARGDADKLIQEAMGYANERVNRAKGDVARFDSIYA 270
gi 1170267   242 DVNFQSARPPE-EVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDAKGEVERLQRLLP 320
gi 25008546  226 DVNFQTARPPE-EVKEAFDDAIAARENREQYIREAEAYSNEVQPKAHGKAQRILEEAKAYSSRRILEAQGEVVRFLKILP 304
gi 123095    235 DVNFQAARPPE-EVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLP 313
gi 20138381  225 DVNFQSARPPE-QVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQFEKLLP 303
gi 6647518   187 QVQIRNALPPKgKVYEAFEDVNIAIQDKNKYINEGRKEFNQIVPKIKGEALKVIEEARGYKESRINNALADTEIFNAILD 266
gi 499257942 238 QVNVQSAAAPR-EVQEAFDDVIRAREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIARAKGEADRFTKLLA 316
gi 499195440 203 GLTLPDARPPE-EVKSAFDEVNGAQQVRERLIDEAQAYAAKVVPEARGRAASNRTAAEGYKQAVIARAQGDADRFTLLQA 281
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 6647523   271 EYVKAPHVTKTRLYLEGLGAILEKTENVLLIDKKLeNLLTLKDIS 315
gi 1170267   321 EFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNG-NNLTVLPLE 364
gi 25008546  305 EYRKNKEMTLKRLYIESMEKLLSKTKKIFID-KKN-HSKLFLSLN 347
gi 123095    314 EYKAAPEITRERLYIETMEKVLGNTRKVLVN-DKG-GNLMVLPLD 356
gi 20138381  304 EYQAAPKVTRDRLYLDAMEQVYSNTSKVLIDSESS-GNLLYLPID 347
gi 6647518   267 AYLKNPDITKERLYNETMKEILENKDNIELIDKNFkNFLPFKEVK 311
gi 499257942 317 EYRKAPDVTRERLYLETMQEVYSNSSKVMVATKDGqSNLLYLPLD 361
gi 499195440 282 QYKNAPEVTRKRLWLETIQQVLAQNRKVIGADGRQ---LIYVPIA 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap