Conserved Protein Domain Family
nqrB

?
TIGR01937: nqrB 
NADH:ubiquinone oxidoreductase, Na(+)-translocating, B subunit
This model represents the NqrB subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130992
View PSSM: TIGR01937
Aligned: 6 rows
Threshold Bit Score: 589.449
Threshold Setting Gi: 34541752
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15214141    2 LKKFINSLWKLCQQ-DKYQRFTPIVDAIDTFCYEPIETPSKPPFIRDSVDVKRWMMLVVIALFPATFVAIWNSGLQSIVY 80
gi 15214126    2 LEKFVDSLWKFCRK-SKFQYMTPVADAVDSFCFEPLHTPSSPPFVRDAVDVKRWMMLVVIALMPTVFVAIWNSGLQALVY 80
gi 15214102    3 LKKFLEDIEHHFEPgGKHEKWFALYEAVATVFYTPGIVTNKSSHVRDSVDLKRIMIMVWFAVFPAMFWGMYNAGGQAIAA 82
gi 15214088    3 LKNLFEKMEPAFLPgGKYSKLYPIFESIYTLLYTPGTVTHKNTHVRDALDSKRMMITVFLALFPAIFYGMYNVGNQAIPA 82
gi 15214109    3 LRNLLDKVEHHFEKgGRYEKWYPLYEAVDTFLYRPGSVTRTTAHVRDGIDLKRMMIIVWLCTFPAMFFGMYNVGHQANLI 82
gi 499258976   4 LRNQLNKLKPHFEEgGKLHGLHSVFDGFETFLFVPNRTSQHGVHVHDAIDSKRTMIVVCMALLPALLFGMYNVGVQHYMA 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15214141   81 SSGN------PVLMEQFLHISGFGSYLSFVYKEIHIVPILWEGLKIFIPLLTISYVVGGTCEVLFAVVRGHKIAEGLLVT 154
gi 15214126   81 QSSD------PQIMEAFLHISGFTSYFSFVSKEIGIASVLFAGCKIFLPLLFISYAVGGTCEVLFAIIRKHKIAEGLLVT 154
gi 15214102   83 LNHMyagdqlATVISGNWHYWLTEMLGGTIAADAGVGSKMLLGATYFLPIYATVFLVGGFWEVLFCMVRKHEVNEGFFVT 162
gi 15214088   83 LNQLgn---lDQLIANDWHYALASSLGLDLTANATWGSKMALGAIFFLPIYLVVFTVCTIWELLFSVVRGHEVNEGMFVS 159
gi 15214109   83 FAQsp----dLLSAQDGWRFALIGALAG-FDPNSLWD-CLVQGAAYFLPVYLTTFIVGGFWEVLFASIRRHEVNEGFFVT 156
gi 499258976  84 IDAP-----------------------------VVFWPAFLFGLLAVLPKLIVSYAVGLGIEFAVAQYRKEEIQEGFLVS 134
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15214141  155 GILYPLTLPPTIPYWMAALGIAFGIVVSKELFGGTGMNILNPALSGRAFLFFTFPAKMSGD-VWVGSNPgvikdslmkMN 233
gi 15214126  155 GMLYPLILPPTIPYWMAALGIAFGVVIGKELFGGTGMNILNPALTGRAFLFFTFPAKMSGD-VWVGSNPskikeslamMN 233
gi 15214102  163 SILFALIVPPTLPLWQAALGITFGVVVAKEIFGGTGRNFLNPALAGRAFLFFAYPAQISGDvVWT--------------- 227
gi 15214088  160 TILFALIVPPTLPLWQAALGITFGIIVAKEIFGGVGRNFMNPALAGRAFLFFAYPAQISGDtVWT--------------- 224
gi 15214109  157 SVLFALTLPPSVPLWQVALGISFGVVLGKEVFGGTGKNFLNPALVGRAFLFFAYPAQMSGDaVWT--------------- 221
gi 499258976 135 GLLIPMIVPVDTPLWMIAVATAFAVVFAKEVFGGTGRNIFNVALVTRAFLFFAYPAAMSGDqVFVRTAD---------TF 205
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15214141  234 SSTGKVLIDGFSQSTCLQTLNSTPPSVKrlhvdaiaanmlhiphvptqdvihsqfslwtethpgwvldnltltqLQTFVT 313
gi 15214126  234 SLAERSNFDGFSQSTCLQILNSTPPSVKrvhidaiasnilklehvpsqevlqsqfstwaesfpgltvdqlsldqLQNFVT 313
gi 15214102  228 ------AADGFSGATALSQWAQGG-NGA----------------------------------------------LVNTVT 254
gi 15214088  225 ------AADGFSGATALSQWSQGG-QGA----------------------------------------------LQHTVT 251
gi 15214109  222 ------SVDGFAGATSLSLAAAGG--------------------------------------------------VD-NIL 244
gi 499258976 206 GLGAGTVADGFSGATPLGQIATAGAKMP----------------------------------------------EIHNVA 239
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15214141  314 APVAegglgllptqfdsayaitdviygigkfSAGNLFWGNIIGSLGETSTFACLLGAIFLIVTGIASWRTMAAFGIGAFL 393
gi 15214126  314 SPTAegglgllpahfdaaysltdaiygigkfSTGNLFFGNIVGSLGETSTVACLLGAGLLLLTGIASWRTMLSFGLSSLF 393
gi 15214102  255 GSPI---------------------------TWMDAFIGNIPGSIGEVSTLALMIGAAMIVYMRIASWRIIAGVMIGMIA 307
gi 15214088  252 GAPI---------------------------TWMDAFVGNLPGSMGEVSTLAILIGGAVIVFTRIAAWRIIAGVMIGMIA 304
gi 15214109  245 GHGL---------------------------TWMDAFLGHMQGSMGETSTLAIFIGGAVLLLTRIASWRIVAGVMLGMVA 297
gi 499258976 240 GDPS---------------------------SLMDAFLGFIPGSIGETSTLAILIGAVLLIWTGIASWKIMLSGLVGASA 292
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15214141  394 TGWLFKFIsvlivgqnGAWAPARFFIPAYRQLFLGGLAFGLVFMATDPVSSPTMKLGKWIYGFFIGFMTIVIRLINPAYP 473
gi 15214126  394 FAWLFKIIsilaagqsGAWAPAKFFIPVYRHLFIGGLAFGLVFMATDPVTSPATKLAKWFYGAFIGFLTILIRLINPAYP 473
gi 15214102  308 VSTLFNVI--------GSDTNPMFNMPWHWHLVLGGFAFGMFFMATDPVSASFTNKGKWWYGILIGAMCVMIRVVNPAYP 379
gi 15214088  305 TSTLFNLI--------GSETNPMFSMPWHWHFVLGGFALGMVFMATDPVSASFTNTGKWWYGALIGVMAVLIRTVNPAYP 376
gi 15214109  298 MSYLFNAI--------GSASNPMFAMPWYWHLVTGGFAFGMIFMATDPVSASMTDTGKWLFGALIGVMVMLIRVVNPAFP 369
gi 499258976 293 MALVFNAI--------GTT--AAMQITPLMHIVYGGFAFGLVFMATDPVTSARTEKGKWIFGFFVGLMAVFIRVLNPGYP 362
                        490       500
                 ....*....|....*....|....*....
gi 15214141  474 EGVMLAILLGNVFAPLIDYFAVRKYRKRG 502
gi 15214126  474 EGVMLAILLGNVFAPSFDRIALKQYRQRR 502
gi 15214102  380 EGMMLAILFANLFAPLFDHVVIEKNIKRR 408
gi 15214088  377 EGMMLAILFANLFAPIFDYIVVQANIKRR 405
gi 15214109  370 EGMMLAILFANLFAPLIDHFVVQANIKRR 398
gi 499258976 363 EGMMLAILLMNVFAPLIDYFVVDSNIKAR 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap