Conserved Protein Domain Family
nqrE

?
TIGR01940: nqrE 
NADH:ubiquinone oxidoreductase, Na(+)-translocating, E subunit
This model represents the NqrE subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130995
View PSSM: TIGR01940
Aligned: 6 rows
Threshold Bit Score: 294.748
Threshold Setting Gi: 34541749
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6166578     2 EHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVYNLvLRENALVEG------VDL 75
gi 15214160    2 EHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPVNQLVYSL-LKDGAIAEG------VDL 74
gi 15214156    2 EHYISLFVKAVFVENMALAFFLGMCTFIAISKKVETAIGLGIAVIVVQTITVPANNLIYTYlLKDGALAWAgl--peVDL 79
gi 15214183    3 ESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYiLRENALIDG------VDL 76
gi 15214123    9 INLLGIFLQATFIQNILLSTFLGMCSYLACSSRLSTANGLGMSVALVLTITGSINWLIHHFvTGPHALSWLspalanIDL 88
gi 499258975   1 MDYISMFVRSIFVDNMVFAYYLGMCSFLAVSKNVKTSIGLGAAVTFILVCTLPINYLLQNYiFKAGALSWLgsqyaeVDL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6166578    76 SFLNFITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYN-FAESIVYGFGSGVGWMLAI 154
gi 15214160   75 TFLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCAIFGAVSFMAQREYN-FGESVVYGFGAGLGWMLAI 153
gi 15214156   80 SFLGLLSYIGVIAAIVQILEMLLDKYVPSLYNALGVFLPLITVNCAIMAGSLFMVERDYN-LAESTVYGVGSGFSWALAI 158
gi 15214183   77 SFLDFITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYT-FTESFVYGTGCGLGWMLAI 155
gi 15214123   89 SFLELITFIVVIAAFTQILELLLERFSRNLYLALGIFLPLIAVNCAILGGVLFGITRNYP-FLPMVVFSLGSGCGWWLAI 167
gi 499258975  81 SFLSLIIFIAVIASFTQLVEMVVERFSPSLYASLGIFLPLIAVNCAILGGSLFMQQREFInVGMATVYGFGSGIGWMLAI 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 6166578   155 VALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGVQ 197
gi 15214160  154 VALAGITEKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQ 196
gi 15214156  159 AALAGIREKLKYSDVPEGLQGLGITFITIGLMSLGFMSFSGVQ 201
gi 15214183  156 ISMAGLREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIR 198
gi 15214123  168 VLFATIREKLAYSDIPQHLQGMGISFITTGLIAMAFMGLTGID 210
gi 499258975 161 VGMAAIREKLAYSNVPKPLRGLGITFIITGLMGIAFLSFSGVK 203
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap