Conserved Protein Domain Family
rnfA

?
TIGR01943: rnfA 
electron transport complex, RnfABCDGE type, A subunit
The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the A subunit. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 130998
View PSSM: TIGR01943
Aligned: 8 rows
Threshold Bit Score: 222.613
Threshold Setting Gi: 25091187
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17380286    2 TDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLIYLRTLAFILVI 81
gi 17380289    2 QDFLLVLLSTALVNNVVLVKFLGLCPFMGVSRKTDAAIGMGLATTFVITVASAACWLVEALILEPLDLKFLRILSMILVI 81
gi 25091187    2 KSYFFFILSNILIDNFILVKFLGLCPFIGASNQIKQAFGISFATSFVVVVSTVLLWFVNFFILLPFDLVYLRIIVYMLII 81
gi 500031653   7 SNFLLILISTVFVNNYVLAKFLGICPFLGVSKKVETAVGMTQAVMFVMTLASVISWLVQHYILDPLNLGYLQTISFILII 86
gi 499319721   1 MELFLIFIGAMLVNNFVLSQFLGICSFIGVSKKKEAAVGMGLAVTFVMVLASIISWLVYNLILDKFNITYLKTIVFVLVI 80
gi 490184340   1 MKVFLLFFSAIFVNNFVLARFLGICPFLGVSKRLETATGMGIAVTFVMTVSAAISWFLDKL-LISTGLEFLRTIVFILVI 79
gi 492525469   1 MEFFMLFIAAVFVNNVVLSQFLGICPFLGVSKKVDTSIGMGAAVTFVLALATLVTFLIQKFVLDRFGLGFMQTIAFILVI 80
gi 499330218   6 eSLFTIFLEGVFIKNFLLIQFLGLCSFVGVTKDLKSASGMSGAVVFVMAMAATVSFALYNFILVPLKLEFLRTIAFIVVI 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17380286   82 AVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVA 161
gi 17380289   82 AAIVQFIETVMRKVTPDLHKALGIYLPLITTNCAVLGLPLMYIQGHLSLAMSTLSGFGASVGFTLVLVIFAGMRERLAQL 161
gi 25091187   82 SFGVQLIEIILRGTSPILYRILGIFLPLITTNCAVLAIPLFSLYLNHTFLESILYAVSASFGFTLVMVIFSSIRERILLS 161
gi 500031653  87 ASLVQLTEMVVHKTSPVLYASLGIFLPLITTNCAVLGVALLNIQQENNLINASFYGVGAGLGFGLVLILFAGMRERVDLS 166
gi 499319721  81 ASLVQFVEMVVKKYSPSLYKALGIFLPLITTNCAVLGMAVTNVEEVYNLIQSIVHALGAAGGYMLAIVLMSFLREKIDDN 160
gi 490184340  80 ASFVQFVELFLKKTSPDLYEALGIFLPLITTNCAILGMVLLNSLMKLNFVEAVFHALGSGLGFALALVIFAGIREKMDLY 159
gi 492525469  81 AALVQMVEIILKKVSPPLYQALGVFLPLITTNCCVLGVAILVIQKDYTLLQSFVYAISTAIGFTLAMVTFAGIREQLDMT 160
gi 499330218  86 AALVQLVEFIVRKHVPALYRSLGIYLPLITTNCAVLGAVLLNVMNDYDLAQSVVFGVAAGLGYTVAMLMMAAIRERSDLV 165
                        170       180       190
                 ....*....|....*....|....*....|..
gi 17380286  162 -DVPAPF-RGNAIALITAGLMSLAFMGFSGLV 191
gi 17380289  162 -SVPAAF-AGTPIAFVSAGLLGLAFMGFAGLV 191
gi 25091187  162 -DVPLAF-QGSPIVLITVSLISIVFMGFKGLV 191
gi 500031653 167 -DVPRLF-KGSPISLINAGLMSLAFMGFAGLV 196
gi 499319721 161 eEIHPYF-RGLPITLFTAALMSIAFLGFQGLI 191
gi 490184340 160 -DLPEPF-KGTAIALITAGLLSLAFMGFQGMV 189
gi 492525469 161 -NLPKAM-KGIPSALLAAGILAMAFMGFSGIA 190
gi 499330218 166 -EVPKSVgRGVTYAFFIATIMSMSFVNFFGVI 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap