Conserved Protein Domain Family
rnfD

?
TIGR01946: rnfD 
electron transport complex, RnfABCDGE type, D subunit
The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the A subunit. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131001
View PSSM: TIGR01946
Aligned: 10 rows
Threshold Bit Score: 381.328
Threshold Setting Gi: 18310392
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495612     7 SPHTHSGKLTAHIMLWAILAMMPAFFTQIYYFGFGVVLQSALAIGTAIIAEFIAIKLRGKKPLNYLSDFSVALTALILAM 86
gi 25091176    3 FPCIYHVYSIRKIMFLVIVACLPGIFAKYYFFGIGTLIQIFFSIFISLVLEIIILKIRSKNIKNYLQDTSLVLTSVLFGV 82
gi 2495611     8 SPYTHNQRQTSRIMLLVLLAAVPGIAAQLWFFGWGTLVQILLASVSALLAEALVLKLRKQSVAATLKDNSALLTGLLLAV 87
gi 17369135    8 SPHLRSKRSTADVMRWVLACALPGLIAQTYFFGYGTLIQLLLAISVAVALEAGIMLLRKRSPISALRDYSAVVTAWLLAV 87
gi 17369002    8 SPHARGSNRTPAIMRLVLGACVPGLLTLTWLYGPGTLLNLAWASLVALACEAAMLALRKRPPGVFLKDGSALVTALLLAV 87
gi 499384983   8 SPHVTRNLQTSTVMQRVILCLLPGLVVQCAFFGWGTLIQVLLAIIVALSCEAAVMKLRKRSIKASLGDNSAMLTAILIGV 87
gi 490184337   8 APHLREEDDVRKIMLDVLIALSPAVIGAAYFFGWYALFLCIAGAVIGELFDIFVMRYLRG-VKDFVPDGSGAVTGLLLAM 86
gi 490722229  10 SPHIHSGDSIKKNMYGVLIALLPALAMSVYQFGIGAVIVTAVSVLTCCIVEYLISKYMLGK-EPTIMDGSAILTGVLLAF 88
gi 499325199  10 APHIRTAETVESVMYDVVIALIPAFAMAVYTFGVRALILTAVSVLTCILTEYLCQKALKRDIEAF--DGSAILTGILFSF 87
gi 499319941  27 SPHIKDKLSTQSIMRDVLIALIPTSLVGVLVFGLRAIFIIATCAISAVISEYAFQKITKKEI--TIKDLSAIVTGVLLAL 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495612    87 AIPPYAPYWIIIIGTLCAVLLGKQVYGGLGQNPFNPAMIGYVILLISFPLQMTTWMPPINLL----QepptFSDAFSLIF 162
gi 25091176   83 SIPPLLPWWMTSIGLFFAIVVAKHLYGGIGQNIFNPAMVGYAVLLISFPVYMNNWNERDFSL----SffndFKKSAYIIF 158
gi 2495611    88 SIPPLAPWWMVVLGTVFAVIIAKQLYGGLGQNPFNPAMIGYVVLLISFPVQMTSWLPPHEIA----VnipgFIDAIQVIF 163
gi 17369135   88 AIPPLSPWWVVVIGLIFAIVIAKHLYGGLGQNPFNPAMIAYVVLLISFPVQMTSWMAPIKLT----AepssLVDSFSLIF 163
gi 17369002   88 ALPPYAPWWLTLVATFFALVFGKHLYGGLGQNPFNPAMLGYVVALVSFPLEMTRWPSPDSAL----G----LPDSLREFL 159
gi 499384983  88 AIPPLAPWWMIVMGTAFAIVIVKHLYGGLGHNLFNPAMAAYVLLLVSFPLQMTTWIAPSTVAlntpS----IVDSLQLIF 163
gi 490184337  87 NVSTRLPFWAFLLGLVFALGIGKHVFGGLGQNIFNPALVGRAFLLISFPTYMTTWVVPGAGF----W------------- 149
gi 490722229  89 NLPSNLPVWIIIIGAVVAIALGKMSFGGLGNNIFNPALVGRVFLLISFPAQMTLWPTEGQM------------------- 149
gi 499325199  88 VVPAIMPLQYVVVGNIVAITLGKMVYGGLGHNIFNPALVGRAFVQASWPVAITTFAFDGK-------------------- 147
gi 499319941 105 NLPINTPLWVACIGSIVAIVLVKQIFGGIGCNFMNPALAARAFLLAAWPESISIFT------------------------ 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495612   163 SGLTTdgftlsqlthNIDGITQATPLDSAKIFYkSH-TQLNdfyeLIKLPIFMGNgtDFAQGWWQINVAFLAGGIFLILK 241
gi 25091176  159 FKNDIttvsssylniIPDAFTTATPLNNFKIKS-HL-KDDF----FLKENIIKNKevSIQTSWKCINISFFLGGIFLLFT 232
gi 2495611   164 SGHTAsggdmntlrlGIDGISQATPLDTFKTSVrAG-HSVEq---IMQYPIYSGI--LAGAGWQWVNLAWLAGGVWLLWQ 237
gi 17369135  164 GGFDSdglslqqirtGIDGITMATPLDAFKTSLkAG-HTMSe---TLTQPQFSG---FAGIGWEWVNIAYLLGGLILLKL 236
gi 17369002  160 GLATR-----------PDAWAHATALDVLKTDRsLT-VDEL----FAGNPAFGH---LGSAGSEWVNLAFLLGGLFLLWR 220
gi 499384983 164 NVGAHvgme--qfrlGIDGISMATPLDTLKTDLsLGlTTTE----SMAKSIFDG---STGVGWFWVNLAYLAGGIVLLKL 234
gi 490184337 150 ---KS----------PADVVTAATPLALFKEHG------VF----TPYWDLFIGK--VGGSLGETSALLLIIGFIYLLLR 204
gi 490722229 150 ---TS----------YLDAETGATPLGLMKAAMsGD-TSALan-iPTDLHMFIGE---AGSLGEVSAIALLLGLVYMLYK 211
gi 499325199 148 --------------------AGATVLDAMKRGIpLS-DALLen-tNQYIDAFLGQ--MGGCLGETSSLALLIGGAYLIYK 203
gi 499319941 161 ----------------LDGITTATPLALLKNGQgN-----L----PPLSNAFLGN--IAGCIGEVSSLAILIGALYLLYR 213
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2495612   242 RVIHWQIPVAMLVTFFCLATATAFTG--FTHLSAISQLVSGAMMFGAFFIATDPVTASITPRGKIIFGALVGLFVYLIRY 319
gi 25091176  233 KIICWRIPISFLSSLGMLSIITYFYSk-ELFMSPQVHFFSGGTMICAFFIATDPVTAACNNVGKIVFGIIIGFLVWIIRN 311
gi 2495611   238 KAIRWHIPLSFLVTLALCAMLGWLFSp-ETLAAPQIHLLSGATMLGAFFILTDPVTASTTNRGRLIFGALAGLLVWLIRS 316
gi 17369135  237 RIIRWHIPMAMLAGLVFTALLAQLFAp-GTTASPMIHLLSGATMLGAFFIATDPVSASTTDKGRLIYGFFIGAMVFLIRS 315
gi 17369002  221 RLFTWHAPLGMLAGLFAMSLLFWNGSgsDSHGSPLFHLFSGATMLGAFFIVTDPVSGATSNRGRLVFGLGVGVLTYVIRA 300
gi 499384983 235 KAIRWHISTGVLAGLFVASSVGFLLSp-DTHASPLFHLFSGATMLAAFFIATDPVTAATSPRGRIIFGALIGVLVYIIRT 313
gi 490184337 205 KRVKIFIPVSYIGTVLVFSSIAYLMNp-R-YGDPLFHLLSGGLMLGALFMATDMVTSPITAKGQVIFGIGCGVLTMAIRL 282
gi 490722229 212 KIITWHIPVSIFASVIVLAGILHLASptSFPATPWFHLFSGGMMLGAIFMATDYVTSPMTKSGQILYGCLIGLLTVVIRT 291
gi 499325199 204 KHIDWKVPAVMIGTVFVLTWAMG--------ADPLMQIFSGGLFLGAFFMATDMVTSPTTSKGRVVFALGLGVLISLIRM 275
gi 499319941 214 KVITWHIPLVYISTVLILTTIIGRNG--FLSGNGIYEIFTGGLFLGAFFMATDYVTSPLTKKGQIIFAFGCGLITTLIRI 291
                        330       340       350
                 ....*....|....*....|....*....|...
gi 2495612   320 HGNYPDGVAFAILLSNICVPLIDHYTRPRVSGY 352
gi 25091176  312 YSDYPDAIAFSVLFANMTVPLVDYYTKSSGYGR 344
gi 2495611   317 FGGYPDGVAFAVLLANITVPLIDYYTRPRVYGH 349
gi 17369135  316 WGGFPDGVAFAVLLANMCVPLIDYYTKPRTYGH 348
gi 17369002  301 WGGYPDGVAFAVLLMNLAAPTIDYYTRPRTYGH 333
gi 499384983 314 QGGYPDAFAFAVLLANLCAPFIDYYVRPRTYGH 346
gi 490184337 283 FGAYPEGVSFSILFMNALVPLIDRYTRPRIFGE 315
gi 490722229 292 FGAYPEGMSFAILIMNGMTPLINTYMKPKHFGG 324
gi 499325199 276 KGGYPEGTAYAILIMNGVVPLIDRYIRPKKFGG 308
gi 499319941 292 FGGYPEGVSYSILLMNLLVPVIDYYIKPKAFGN 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap