2OUG


Conserved Protein Domain Family
RfaH

?
TIGR01955: RfaH 
Click on image for an interactive view with Cn3D
transcription elongation factor/antiterminator RfaH
This model represents the transcription elongation factor/antiterminator, RfaH. This protein is most closely related to the transcriptional termination/antitermination protein NusG (TIGR00922) and contains the KOW motif (pfam00467). This protein appears to be limited to the gamma proteobacteria. In E. coli, this gene appears to control the expression of haemolysin, sex factor and lipopolysaccharide genes. [Transcription, Transcription factors]
Statistics
?
PSSM-Id: 131010
View PSSM: TIGR01955
Aligned: 6 rows
Threshold Bit Score: 238.515
Threshold Setting Gi: 28870605
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OUG_A         4 WYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEFDPEV-IHTTTINATRGVSHFVRFG 82
gi 132482      4 WYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEFDPEV-IHTTTINATRGVSHFVRFG 82
gi 29541420    7 WYLIYTKPRQERIAEENLERQGYRIYLPFIQVNRRRSGCYQLITEPLFPRYLFILLNIDK-DNWGPIRSTRGVSALVRFG 85
gi 446755748   4 WYLLYCKRGEQQRAKMHLENQSVECFYPEVCVEKILRGKRQMVQEPLFPSYMFVRFDFENgPSFTTVRSTRGVVDFVRLG 83
gi 499385590   4 WYLLYCKPRSEVRAQQNLALQNLETYLPMVSEEKSQRGQKRICRVPLFPNYLFINFDPSQ-TSVKQVHSTRGVSRIVNCQ 82
gi 492141662  10 WYLIQTKPRQEARAEEHLRRQDFECFRP-LRAAAKKIAAKAQVEEALFPGYLFIHMDQVH-DNWYPIRSTRGVSRIVTFG 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2OUG_A        83 ASPAIVPSAVIHQLSVYKPKDIVDPAT----PYPGDKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKNTE 158
gi 132482     83 ASPAIVPSAVIHQLSVYKPKDIVDPAT----PYPGDKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKNTE 158
gi 29541420   86 GIPAKVPPDFVQFLKNNETSASVPPKVs--lFQKGQRVQIIDGVMAGYEGVFEMHSGAKRVTLLLDMVGKVTRVEVPLDS 163
gi 446755748  84 PHPRELQGDLIYQLKQLDCEQLKHATKq--lPEKGQTVRVARGQFAGIEAIYLEPDGDTRSIMLVKMISQQVPMSIENTD 161
gi 499385590  83 EKMTPIDDRIIHAIRMKELTPSQSVLDtpleLKTGEKIRFKDGPFADLEAIFQEKCPNKRCHVLFNIMGQINILTVPEQS 162
gi 492141662  88 GHPVPVRDHLIEQIRQR---LCTPAPAl--rFTQGDQVMITTGSWCDVEAIFLTTDGTERAVILLNMLQRQQKVVLPISS 162

                 ..
2OUG_A       159 FR 160
gi 132482    159 FR 160
gi 29541420  164 VT 165
gi 446755748 162 WE 163
gi 499385590 163 VE 164
gi 492141662 163 LS 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap