1UDN


Conserved Protein Domain Family
RNasePH

?
TIGR01966: RNasePH 
Click on image for an interactive view with Cn3D
ribonuclease PH
This bacterial enzyme, ribonuclease PH, performs the final 3'-trimming and modification of tRNA precursors. This model is restricted absolutely to bacteria. Related families outside the model include proteins described as probable exosome complex exonucleases (rRNA processing) and polyribonucleotide nucleotidyltransferases (mRNA degradation). The most divergent member within the family is RNase PH from Deinococcus radiodurans. [Transcription, RNA processing]
Statistics
?
PSSM-Id: 131021
View PSSM: TIGR01966
Aligned: 11 rows
Threshold Bit Score: 401.356
Threshold Setting Gi: 21759403
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UDN_A        2 RSDGRKEDQLRPVSIQRDFLEYPEGSCLISFGKTKVICTASVIENVPNWLKGKGQGWITAEYSMLPRATQQRTIRESVQG 81
gi 21759399   2 RSSGRKKEQIRPVKITRNFTKYAEGSVLIEVGDTKVLCTASIEEKVPPFLKGSGEGWITAEYNMLPRSTQSRKQRDINKL 81
gi 24638170   9 RFDGRAQDQMRAVKITRGFTSNPAGSVLVEFGNTRVMCTASVELGVPRFKRDSGEGWLTAEYAMLPAATAERNRRESMAG 88
gi 21759400   2 RPSGRQPDQLRPVTLTRHYTRHAEGSVLVCFGDTHVLCTASVLPKVPPHKKGSGEGWVTAEYGMLPRSTHTRSDREAARG 81
gi 21759401   2 RVDGRESNALRNIEVTPDYLMHPEGSVLIASGNTKVICSASVETKVPPFMRGEGRGWISAEYSMLPRATNTRNIRESSKG 81
gi 6094114    2 RSDGRKEDQLRPVSIQRDFLEYPEGSCLISFGKTKVICTASVIENVPNWLKGKGQGWITAEYSMLPRATQQRTIRESVQG 81
gi 21759408   2 RPSGRKTDQMRKVSFERSFSKHAEGSCLVRFGDTHVLCTASLEEKVPAWLRNGGKGWITAEYGMLPRATGERMRREAATG 81
gi 6226021    2 RQSGRKSNQLRPISLELSPLINAEGSCLIKIGNTHVMCSATCETTVPPFLRGQNQGWITAEYGMIPGSTSHRIKREAALG 81
gi 21759416   6 RIS-RAADSLRDIKITPHFLPHTDGSCLIECGNTKVICTASIDENVPPFLRGKNQGWVTAEYGMLPASTASRMRREASAG 84
gi 21759403   5 RPDGRKPYELRPINFHTKFTRFAPGSVLTICGETKVLCTVSVAESVPKFLTGSGKGWLTAEYRMLPSATQQRHERE--LL 82
gi 21759422   3 RIDGRTPQQLRPVTIERGWSKHAEGSVLVSFGDTKVLCNASVTEGVPRWRKGSGEGWVTAEYAMLPRATNTRGDRESVKG 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UDN_A       82 RIGGRTHEIQRMIGRAMRTAVELTKIGERTIWVDCDVIQADGGTRTAAITGAFVAVADAIIKLHKEGIIEE--TPIKD-F 158
gi 21759399  82 KIDGRTMEIQRLIGRALRSAVDMKALGEKTIWIDCDVLQADGGTRTTSITGSFVALVDAVNKLHQKKPFNV--YPIRH-F 158
gi 24638170  89 KVKGRTHEISRLIGRSLRAAVDLSQLGENTIAIDCDVLQADGGTRTASITGAYVALADAIKVLQERGVVPGs--PLLA-P 165
gi 21759400  82 KQSGRTQEIQRLIGRAMRSVFDLSALGEHTIHLDCDVLQADGGTRTASITGAFVAAHDAISVMRKKGQLTG--EPIRD-F 158
gi 21759401  82 KVTGRTMEIQRLIGRALRAVVDLDALGERTIWLDCDVIQADGGTRTASITGAFIAMVMAIAKLDEAVPFAK--FPVKD-F 158
gi 6094114   82 RIGGRTHEIQRMIGRAMRTAVELTKIGERTIWVDCDVIQADGGTRTAAITGAFVAVADAIIKLHKEGIIEE--TPIKD-F 158
gi 21759408  82 KQSGRTQEIQRLIGRSLRAVVDLPALGERQISIDCDVIQADGGTRTASITGAWIALHDCLKWMEARNMVKL--EKVLKdH 159
gi 6226021   82 KQGGRTQEIQRLIGRAMRCVINLQKLGERQIIIDCDVINADGGTRTAAITGSYVALHLAIRSLMKKRILKV--NPLIS-Q 158
gi 21759416  85 KQSGRTQEIQRLIGRSLRAVVDMEKLGERQILIDCDVIQADGGTRTASITGAFVALQIAVGKLVSDGILSE--NPIRE-A 161
gi 21759403  83 KLSGRTQEIQRLIGRSLRAALDFEALGERTLTVDADVLQADAGTRTAAITGGFVALAEAISQLLQRGVLER--SPLCG-Q 159
gi 21759422  83 RIGGRTHEISRLIGRSLRAVIDYKALGENTVVLDCDVLQADGGTRTAAITGAYVALADAVAWAQGRKLIKAnrKPLTG-T 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UDN_A      159 VAAVSVGIVNDR-ILLDLNFEEDSAAQVDMNVVGTGSGRLSEVHTMGEEYSFTKDELIKMLDLAQKGINELIELQKKLYV 237
gi 21759399 159 VSAVSVGIVGEE-KILDLCYEEDHVAKVDMNVVMTEEGEFIEIQGTGEAGPFSRKELDELLNLAEKGAKQMIQAQKDALK 237
gi 24638170 166 VAAVSVGLVDGN-VCLDLPYEEDSRADVDLNVVMTEHGEFVEIQGTGEETTFTRAQLNDMLDHAEKGCRELVAAQKAALG 244
gi 21759400 159 VAAVSVGVVDGV-PVLDLDYPEDASCDTDMNIVMTGAGGFVEVQGTAEGTPFTRTEMDALLGLADHGIRTLIGLQKQALG 237
gi 21759401 159 LAATSVGVLEEGgTVLDLNYVEDSAAQVDMNIIMTGSGAFVELQGTGEEATFSETELAELIALGKKGISELIEIQKETLG 238
gi 6094114  159 VAAVSVGIVNDR-ILLDLNFEEDSAAQVDMNVVGTGSGRLSEVHTMGEEYSFTKDELIKMLDLAQKGINELIELQKKLYV 237
gi 21759408 160 VAAISCGIFANQ-PVIDLDYLEDSAAETDANFVMTGSGGLVEIQGTAEGKPFSEEEFASLMLLAKNGIAELVEMQKQAIA 238
gi 6226021  159 IAAISCGIYKGN-AVLDLDYLEDSDAEVDSNFVFACNGNLIEVQGTAEKEPFSEEQFLAMLKLAKSGVVELFKLQNQVLI 237
gi 21759416 162 VAAVSVGVVNGV-PLLDLDYPEDSGCDSDVNIVMTASGKIIEIQGTAEDAPFSLDELGKLVALAQKGIGELLQHQQNALS 240
gi 21759403 160 IAAVSVGLLEQE-AYLDLNYIEDVAATVDFNVVMNKNLGIIEVQGTAEEGSFSRTQLNQLLDCAETGIQQLLIAQQQAIT 238
gi 21759422 162 VSAVSVGIVDGT-PLLDLRYEEDVRADTDMNVVCTGDGRFVEVQGTAEAEPFARDELNTLLDLATAGCTELAELQRKALD 240
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap