Conserved Protein Domain Family
minD_bact

?
TIGR01968: minD_bact 
septum site-determining protein MinD
This model describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum. The homologous archaeal MinD proteins, with many archaeal genomes having two or more forms, are described by a separate model. [Cellular processes, Cell division]
Statistics
?
PSSM-Id: 131023
View PSSM: TIGR01968
Aligned: 9 rows
Threshold Bit Score: 407.109
Threshold Setting Gi: 3024144
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8928198     2 GNVIVVTSGKGGVGKTTITANLGCALAKLGEKVCLIDADIGLKNLDIVLGLENRIVYTMIDVVNGKVSPQEALVKHKMLK 81
gi 400260      2 GEAIVITSGKGGVGKTTTSANLGTALAILGKRVCLVDTDIGLRNLDVVMGLENRIIYDLVDVVEGRCKMHQALVKDKRFD 81
gi 8928204     2 AIVVTITSGKGGVGKSTTTANLAIGLAESGKKVVAVDFDIGLRNLDMILGLENRIVYDVVDVMEKNCNLSQALITDKKTK 81
gi 3024135    16 ERVIVITSGKGGVGKTTTTANLGMSIARLGYRVALIDADIGLRNLDLLLGLENRVLYTAMDIVEGQCRLDQALIRDKRWK 95
gi 6016572     2 ARIVVITSGKGGVGKTTVTANLGMALAQLGYRTALIDADIGLRNLDLLLGLENRVIYTALEVLSGECRLEQALIKDKRQP 81
gi 3024144     2 NRIIVVTSGKGGVGKTTTTANLGAALARLGKKVVLIDADFGLRNLDLLLGLEQRIVYTAIDVLADECTIDKALVKDKRLP 81
gi 499267169   2 GEAIVITSGKGGVGKTTTTANIGTALAAMKKKVVLVDGDTGLRNLDVLMGLENRIVFTLLDVVEGNCRLKQALIKDKHYE 81
gi 499189858  11 AKVIVVTSGKGGVGKTTTTANIGAALARLGEKVVVIDVDVGLRNLDVVMGLESRVVFDLVDVLEGKCRMNQALIRDKRVE 90
gi 489345434   2 AKILVVTSGKGGVGKTTTSAAIGTGLALRGHKTVIVDFDVGLRNLDLIMGCERRVVYDFVNVVNGEANLQQALIKDKRLE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8928198    82 -NLYLLPASQIATKEMISPNDMKAIVKELIPh--FDYIIIDSPAGIERGFRNAVAPAERVLVVTTPELPAISDADRVIGL 158
gi 400260     82 dLLYLMPAAQTSDKTAVAPEQIKNMVQELKQe--FDYVIIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGL 159
gi 8928204    82 -NLSFLAASQSKDKNILDKEKVAILINALRAd--FDYILIDSPAGIESGFEHAILHADMALVVVTPEVSSLRDSDRVIGI 158
gi 3024135    96 -NLALLAISKNRQKYNVTRKNMQNLIDSVKEl-gFQFVLIDCPAGIDVGFINAIASAQEAVIVTTPEITAIRDADRVAGL 173
gi 6016572    82 -NLVLLPAAQNRNKDSVTEEQMKFLVN-LLVn-dYDYLLIDCPAGIETGFHNAIGPAQEAIVVTTPEIAAVRDADRVIGL 158
gi 3024144    82 -NLVLLPAAQNRSKDAINAEQMQSLVEQLKDk--FDYIIIDCPAGIEAGFRNAVAPAQEAIIVTTPEMSAVRDADRVIGL 158
gi 499267169  82 -NLALLPTAQTRDKNDVKPEQMLKLVNELKEe--FDYVIIDCPAGIEQGFENAVIGADRAIVVVNPEVTSVRDADRVIGK 158
gi 499189858  91 -NLHLLPASQTRDKDALDPEVFKEVVKGLLEeegFDRVLIDSPAGIESGFRTAAAPAEGALVVVNPEVSSVRDADRIIGL 169
gi 489345434  82 -NLYVLAASQTRDKDALTQEGVEKVLMDLKKd--FEYVICDSPAGIEKGAHLAMYFADEAIVVTNPEVSSVRDSDRMLGI 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8928198   159 LENFGfSD--------Ek-----INVIINRFKPHMVKKGEMLTTDDIKHTLSLEIIAVIPDSEDIIVASNTGIPVSLNGN 225
gi 400260    160 LEQEEnIE--------P------PRLVVNRIRNHLMKNGDTMDIDEIVQHLSIDLLGIVADDDEVIKASNHGEPIAMDPK 225
gi 8928204   159 IDAKSnRA--------KsgeevhKHLIINRLKPELVANGEMISIEEVLKILCLPLIGIIPEDHHIISATNKGEPVIRTD- 229
gi 3024135   174 LEANG-IY--------N------VKLLVNRVRPDMIQKNDMMSVRDVQEMLGIPLLGAIPEDTSVIISTNKGEPLVLNKK 238
gi 6016572   159 LEANG-IK--------Q------IKLLVNRLRPQMVKANDMMSVADVREILAIPLIGVIPEDECVIVSTNRGEPLVLEKN 223
gi 3024144   159 LEAED-IG--------K------ISLIVNRLRPEMVQLNQMISVEDILDLLAVPLIGILPDDQKIIISTNKGEPLVMEEK 223
gi 499267169 159 IDAKG-IE--------D------HQVIVNRIDYEMVKRGDMLGIEDVIDNLAIKLIGVVPNDKQITVSTNKGEPIVLNQN 223
gi 499189858 170 LEAQQ-IT--------E------IRLVVNRLRPKMVASGNMLSIDDMVDILGVKPIGIVPEDEGIIVSTNVGEPAVL-GK 233
gi 489345434 159 LSSKS-RRsengeepiK------EHLLITRYHPERVVKGEMLSVADVEEILSIKLKGVIPESQAVLKASNQGIPVILDDQ 231
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 8928198   226 -SRISKNFENLARRIRGEGVPLENdFVTVSKGLIDTLKDFF 265
gi 400260    226 -NRASIAYRNIARRILGESVPLQV-LEEQNKGMMAKIKSFF 264
gi 8928204   230 -CESAKAYQRITRRILGEEVEYVE-FK-AKRGFFSALKGIF 267
gi 3024135   239 lTLSGIAFENAARRLIGKQDYFID-LTSPQKGMFQKLQEFF 278
gi 6016572   224 lSLPGLAFEHTACRLDGQEIEFLD-LQSYSRGPLKRLRRFF 263
gi 3024144   224 lSVPGLAFQNIARRLEGQDIPFLD-FMAAHNTLLNRIRRRL 263
gi 499267169 224 -ANAGKAFRDIARRVLGEEVPFEK-YETQT-GFIAAIKKIF 261
gi 499189858 234 -TKAGDAFMATAQRIQGQDVPFPK-LTEEEKGIWAAIRRLF 272
gi 489345434 232 -SDAGQAYSDAVDRLLGKEKPMRF-IDVQKKGFFERIFGSK 270
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap