1HYQ


Conserved Protein Domain Family
minD_arch

?
TIGR01969: minD_arch 
Click on image for an interactive view with Cn3D
cell division ATPase MinD, archaeal
This model represents the archaeal branch of the MinD family. MinD, a weak ATPase, works in bacteria with MinC as a generalized cell division inhibitor and, through interaction with MinE, prevents septum placement inappropriate sites. Often several members of this family are found in archaeal genomes, and the function is uncharacterized. More distantly related proteins ParA chromosome partitioning proteins. The exact roles of the various archaeal MinD homologs are unknown.
Statistics
?
PSSM-Id: 131024
View PSSM: TIGR01969
Aligned: 7 rows
Threshold Bit Score: 357.504
Threshold Setting Gi: 14520779
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HYQ_A         3 RTITVASGKGGTGKTTITANLGVALAQLGHDVTIVDADITMANLELILGMEGLPVTLQNVLAGEARIDEAIYVGPGG-VK 81
gi 2496034     7 IAIAIASGKGGTGKTTISANLAVALAKFGKKVAVLDADIAMANLELIMGLEGKPVTLNDVLAGKADIKDAIYEGPEG-VL 85
gi 499328098  13 RVVCMASGKGGTGKTTVTANLGTALAELGAETYILDADIAMANLGLILRMEDAPVTLHDVLAGEADIEEAIYEGPHG-VK 91
gi 2495840     4 MIITIASGKGGVGKTTTSASLAVALAKLGKKVLAIDGDISMANLGILFNMEKKKPSLHEVLSEEADVRDAIYKHKTG-VY 82
gi 499170276   3 RIISIVSGKGGTGKTTVTANLSVALGEMGKKVLAVDGDLTMANLSLVLGVDDVDVTLHDVLAGEAKLQDAIYMTQFDnVY 82
gi 499179902   3 RVITVASGKGGVGKTTITANLGVALSTYGERVVVLDADIAMANLELILGMEGKSVTLHDVLAGNASIEDAVYEGPNG-VR 81
gi 499169411   4 RSIVFASGKGGTGKTTTVANIGVALAQFGKDVILIDADITMANLSLILGMEDIPVTLHDVLAGEADLKDAIYEGPAG-VK 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HYQ_A        82 VVPAGVSLEGLRKANPEKLEDVLTQIMESTDILLLDAPAGLERSAVIAIAAAQELLLVVNPEISSITDGLKTKIVAERLG 161
gi 2496034    86 VIPAGVSLEKFRRAKPEKLEEVLKAIHDLVEILIIDCPAGIGKETLIAISSADGLIVVVNPEISSISDALKIIAITKRLG 165
gi 499328098  92 VIPAGISLEGIRKANPDRLRDVVEHIIDRADFLLIDAPAGLGRDAITALSASTESLLVVNPEIASITDALKVKAVAERVD 171
gi 2495840    83 VLPTSLSLEGYKKSDIDLLPDVVNEVADDFDYVIIDAPAGLNREMATHLAIADKLLLVVTPEMFSIIDAVRLKESAEMAG 162
gi 499170276  83 VLPGAVDWEHVMKADPRKLPEVIKSLKGDYDFILIDCPAGLQLDAMSAMLSGEEALLVTNPEISCLTDTMKVGIVLRKAG 162
gi 499179902  82 VVPAGISLEGLRNVKLDRLEDALAYLIEDTDILLIDAPAGLEKDAVAALAAADELLLVTTPEVPSISDALKTKIVASKLD 161
gi 499169411  83 VIPGGLSLEKIKKARAERLRDLIREISQMGDFILIDAPAGLELTSITALLIGKELIIVTNPEIAAITDSLKTKLVAEKLG 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HYQ_A       162 TKVLGVVVNRITTLGIEMAKNEIEAILEAKVIGLIPEDPEVRRAAAYGKPVVLRSPNSPAARAIVELANYIAGgakkkVP 241
gi 2496034   166 TDIIGAIVNRVSNESTELGVKAIETILEVPVIGVVPEDPHVRKAAAFGTPLVIMYPDSPAAQAIMEIAAKLIG-----AK 240
gi 499328098 172 TQITGAVVNRVTKDKTELTKEEVEKILETPVMVEVPEDPEVRRAAAFGEPVVVRSPKSAAAQAFKKLAAELVG-----IE 246
gi 2495840   163 TPLMGVVLNRVGRDFGEMGRDEIEMLIKGKVLVEVPEDENVRSAALKKMSVIEYRKNSPASQAYMKLASIIAGvp-iyIE 241
gi 499170276 163 LAILGFILNRYGRTENDIPPDAAQDVMDVPLLAVIPEDPAIREGTLEGIPAVKYKPESEGAKAFVKLAQEVEK-----L- 236
gi 499179902 162 INIIGVVINREQYDKTFLSVEEVETILEVPVIAVIPDDPEVSRAAAFGEPIVIKNPKSPASNALMELAADLIG-----EE 236
gi 499169411 163 TLPLGAILNRVTSEKTELSREEIEALLEVPVLGTVPEDPEVKRASAYGVPLVVKNPTSPAAIAYKEIAAKLAG-----IK 237
                        250
                 ....*....|....*...
1HYQ_A       242 AEVKEKKK-EGALAKMLR 258
gi 2496034   241 YEAQLKKKkESFISKFIK 258
gi 499328098 247 YEVPVPDK-EGVLSKVIK 263
gi 2495840   242 DEIKIIRK-ESFIDKIKR 258
gi 499170276 237 ---------AGIKAKVMY 245
gi 499179902 237 YQPIEPDK-QGVIAKLIS 253
gi 499169411 238 WKPPEP---ESPVKRIFR 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap