1ONW


Conserved Protein Domain Family
isoAsp_dipep

?
TIGR01975: isoAsp_dipep 
Click on image for an interactive view with Cn3D
isoaspartyl dipeptidase IadA
The L-isoaspartyl derivative of Asp arises non-enzymatically over time as a form of protein damage. In this isomerization, the connectivity of the polypeptide changes to pass through the beta-carboxyl of the side chain. Much but not all of this damage can be repaired by protein-L-isoaspartate (D-aspartate) O-methyltransferase. This model describes the isoaspartyl dipeptidase IadA, apparently one of two such enzymes in E. coli, an enzyme that degrades isoaspartyl dipeptides and may unblock degradation of proteins that cannot be repaired. This model also describes closely related proteins from other species (e.g. Clostridium perfringens, Thermoanaerobacter tengcongensis) that we assume to be equivalent in function. This family shows homology to dihydroorotases. [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 131030
View PSSM: TIGR01975
Aligned: 5 rows
Threshold Bit Score: 613.331
Threshold Setting Gi: 15613692
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ONW_A         9 FTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPS--DIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPE 86
gi 732085      9 FTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPS--DIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPE 86
gi 489549551   2 LKVIKNIEVYDPEYLGKKDIVILSDKIEGLYDSVNIpkDFINIQVIDG-EGMIAVPGFIDCHVHIIGGGGEGGFRTRTPE 80
gi 499334736   2 FLLLKGLNVYSPEPIGKKDILICCEKVIKIADEIKPfkEFGDVEIVEEVEGLIAVPGFIDQHVHIAGGGGEGGPSTRTPE 81
gi 499199759   2 YTLIKNSEVYTPTYIGKKDMLIVGDRIEAIEDEIELtgKGWEGTVVNG-EDMVVIPGLIDSHVHIIGGGGEGGYKTRTPE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ONW_A        87 VALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGVx-CAI 165
gi 732085     87 VALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGVk-CAI 165
gi 489549551  81 LQLSSIIKGGITTLVGCIGTDGVCRDMKGLVAKAHALCEEGVTCYCYTGSYDVPVNTITKTIKSDLLLIDKVIGVgeIAL 160
gi 499334736  82 ITLSDITKGGITTVVGLLGTDGITRGMASLLAKARALEQEGITTYIYTGAYEIPTRTLTGSVRSDLVLIDKVIGTgeIAI 161
gi 499199759  81 LTLTDATTVGVTTVVGVIGTDGTTRTMPDLIAKAHALEEEGVSCFVLVGSYQLPIKTLTGTLQSDLLLIDKIIGVgeIAI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ONW_A       166 SDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFA 245
gi 732085    166 SDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFA 245
gi 489549551 161 SDHRSSQPTYEQFVNIVAQARVGGLLSGKAGIVNVHLGNGKRMIEYITRLINETEIPANQIIPTHMGRSRELFEAGINHA 240
gi 499334736 162 SDHRSAQPTVEDLTKLAAEARVGGLLGGKPGIVHLHVGDGIRGLSPIFEIVEKTEIPITQFVPTHINRASHLFEHGLKFI 241
gi 499199759 161 SDHRSSQPTIQELTRVAAEARVGGMLAGKGGIVNIHVGDSPEKLRLLEEVVATSDVPVTQFLPTHINRNQDLFWAGVEYA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ONW_A       246 RKGGTIDITSSIDEP------VAPAEGIARAVQAGIPLARVTLSSDGNGSQPFFDDEGNLTHIGVAGFETLLETVQVLVK 319
gi 732085    246 RKGGTIDITSSIDEP------VAPAEGIARAVQAGIPLARVTLSSDGNGSQPFFDDEGNLTHIGVAGFETLLETVQVLVK 319
gi 489549551 241 KAGGQIDLTTSSDPQhleegeVRAGEGLKKLLDAGVDIEKITFSSDGNGSMPLFDENGELKGLGICSVESLFNEVKEAIK 320
gi 499334736 242 EMGGTIDLTSDIKPDphsktaLTPKEAIKKVLENKLPIEKVTMSSDSNGSIPVFDENKKLVKVMVGSTDTLYRDLREAII 321
gi 499199759 241 KKGGIVDFTTSSIPQfrkegeIKPSTGLKMMLEQGVPLENITFTSDAQGSLPAFNESGEYQGLQIGKMASLFSEVRDAVI 320
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
1ONW_A       320 DYDFSISDALRPLTSSVAGFLNLT-GKGEILPGNDADLLVMTPE-LRIEQVYARGKLMVKDGKACVKGTFE 388
gi 732085    320 DYDFSISDALRPLTSSVAGFLNLT-GKGEILPGNDADLLVMTPE-LRIEQVYARGKLMVKDGKACVKGTFE 388
gi 489549551 321 LG-VPLEKAIRVITSNVANVLKLS-HKGFISTGKDADIILLDKKnLDINSVISRGNILMDNKKLLVKGTFE 389
gi 499334736 322 EGIVPLEKGIKIITENVTKVLNLYpRKGCISEKSDADIVILDED-LNIHSVIARGKFMIRKGKIVKKGFFE 391
gi 499199759 321 AEQLPLDVVLHVVTKNPARGLKLR-KKGEIQPGFDADLVMIERDsFTIHHVFAKGQHMVQEGQAIVKGTFD 390
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap