1T3I,1JF9


Conserved Protein Domain Family
sufS

?
TIGR01979: sufS 
Click on image for an interactive view with Cn3D
cysteine desulfurases, SufSfamily
This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131034
View PSSM: TIGR01979
Aligned: 19 rows
Threshold Bit Score: 594.634
Threshold Setting Gi: 13431405
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T3I_A        11 ATVRQDFPILNQEING-HPLVYLDNAATSQKPRAVLEKLMHYYENDNANVHRGAHQLSVRATDAYEAVRNKVAKFINARS 89
gi 13431409    2 KNLKEDFPIFAAKAKEnEPFIYLDSAATTQKPQQVIDAVANFYTSSYATVNRAIYSSSRNVTEAYAAVREKVRKWVSAAS 81
gi 13431392    2 YNVKKDFPIFKNQG---DPYVYLDSAATTHKPQCVIDSIVDYYSSSYATVNRALYTASHDITFAHWQVRSKVGSWIGAQY 78
gi 13431405    4 TGLYEDFPTLKMKING-KRIVYLDSAATTLKPKQVVKKLEEFYYNSYANVHRAVHTLAVRATTEFEETREEFAEFLGAS- 81
gi 13431390   11 AAIRADFPILKRIMRGgNPLAYLDSGATSQRPLQVLDAEREFLTASNGAVHRGAHQLMEEATDAYEQGRADIALFVGADT 90
gi 13431388    4 TDIREQFPILHQQVNG-HDLVYLDSAATSQKPRAVIETLDKYYNQYNSNVHRGVHTLGTRATDGYEGAREKVRKFINAKS 82
gi 499336783   5 KKIREDFPIFNVKPHG-KRLVYLDNAATTQKPESVIKAMEEYYEKMNANVYRSPHYLSVLSTEAYEKARDKVKKFVNAKS 83
gi 445932220   6 ERIRTDFPILGTKMNG-KALVFLDSAASSQKPFTVIDTIEKYYREENANIHRGIYYLSQKATEKYELSRIRLSKFIGAQC 84
gi 499269172   3 nkyiKDFPTLDQEFNG-HKFVYLDNAATTQKPLSVINAVNDYYRKSNANPHRGAYALSVKATDLYEGARDVVKDFINANK 81
gi 13431406   11 EAIRKDFPILDRQVHDgHKLVYLDNAATSQKPRQVLDALSEYYERYNANVHRGVHVLAEEATALYEGARDKVAEFINAPS 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T3I_A        90 PREIVYTRNATEAINLVAYSWGMN-NLKA----GDEIITTVMEHHSNLVPWQMVAAKTGAVLKFVQLD-EQESFDLEHFK 163
gi 13431409   82 DSEIVFTRGTTAGLNLLAISVNDL-WIPK----GGVVLVSEAEHHANVLSWEIACRRRGSLVKKIRVH-DSGLIDLDDLE 155
gi 13431392   79 DQEIIFTRGTTSSLNLLAIAANDS-WLA-----GGTVVISEAEHHANLVSWELACQRSGATIKKVRVD-DEGMVDCSHLE 151
gi 13431405   82 PEEIIFTSGTTMAINLAVVSLLRSgILKE----DDLVLVSLLEHHANFVPWLRLSKFHGYRIDFIRPSgRFGTLEMDDLL 157
gi 13431390   91 D-ELVFTKNATEALNLVSYVLGDS-RFERavgpGDVIVTTELEHHANLIPWQELARRTGATLRWYGVT-DDGRIDLDSL- 166
gi 13431388   83 MAEIIFTKGTTTSLNMVALSYARA-NLKP----GDEVVITYMEHHANIIPWQQAVKATGATLKYIPLQ-EDGTISLEDVR 156
gi 499336783  84 EESIIFTRNTTESINFIAYTWGMK-HIKE----GDEIVLTIAEHHSNILPWQMVAEAKGAKLKYVYLD-ENFRLSMKDFE 157
gi 445932220  85 AKVCIFTRNATESINLVAQTWGRT-QIKE----GDEIVLNELEHHSNIVPWQMLAQEKKAVLKFIPLN-EDSTLDFSNLQ 158
gi 499269172  82 SKEIVFVRNATEALNLVAYSYGLN-FINA----GDEIVISIAEHHSNLVPWQQVAKAKGAVLKYLYLN-EDGIIPHEEFE 155
gi 13431406   91 RDEVIFTKNASESLNLVANMLGWA-DDPYrvdhETEIVITEMEHHSNIVPWQLLAQRTGAKLRWFGLT-DDGRLDLSNID 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T3I_A       164 TLLSEKTKLVTVVHISNTLGCVNPAEEIAQLAHQAGAKVLVDACQSAPHYPLDVQLIDCDWLVASGHKMCAPTGIGFLYG 243
gi 13431409  156 KLLNEGAQFVSIPHVSNVTGCVQPLQQVAELVHRYDAYLAVDGAQGAPHLPIDVQLWDVDFYVFSSHKIYGPTGIGVLYG 235
gi 13431392  152 QLLKQGVQLVSLAHVSNVSGAVLPLPEIAHLVHRYEALFAVDGAQGVGKGPLNLSEWGVDFYAFSGHKLYAPTGIGVLYG 231
gi 13431405  158 KHRDKNPKVVAITGLSNVTGQRIPVEELRNVFPN--SIILLDGAQLIPHEPVKPKEIGVDFLAFSLHKMLGPTGVGVLYG 235
gi 13431390  167 -YLDDRVKVVAFTHHSNVTGVLTPVSELVSRAHQSGALTVLDACQSVPHQPVDLHELGVDFAAFSGHKMLGPNGIGVLYG 245
gi 13431388  157 ETVTSNTKIVAVSHVSNVLGTVNPIKEMAKIAHDNGAVIVVDGAQSTPHMKIDVQDLDCDFFALSSHKMCGPTGVGVLYG 236
gi 499336783 158 EKMSDRVKLVAVQHMSNVLGIINPVEEITQIAHKYGAKVLVDGAQSVPHMKVDLKKINCDFFAFSGHKMLGPMGIGVLYI 237
gi 445932220 159 EIITTKTKLVAISQMSNVTGTIHDILPVQKRAKEVGAKLLVDGAQGVCHLPVNMKEMEYDFYVFSAHKMLGPTGVGVLYA 238
gi 499269172 156 SKITSKTKIVSVTHVSNVLGTINPVNDIIKKAHSVGAIAILDAAQSIPHMEVDVKALDADFVVFSGHKMLAPMGIGVLYG 235
gi 13431406  169 EVITEKTKVVSFVLVSNILGTQNPVEAIVRRAQEVGALVCIDASQAAPHMPLDVQALQADFVAFTGHKMCGPTGIGVLWG 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T3I_A       244 KEEILEAMPPFFGGGEMIAEVFFDHFTTGELPHKFEAGTPAIAEAIALGAAVDYLTDLGMENIHNYEVELTHYLWQGLGQ 323
gi 13431409  236 KKDLLDQLPPVEGGGDMVAIYDHQNPEYLPAPMKFEAGTPNIAGVLGLGAALDYLDGLSAKFIYDKEIALTTYLHKELLE 315
gi 13431392  232 KKELLESLPPVEGGGDMVIVYDFEELSYQEPPLRFEAGTPHIAGVLGLGAAIDYLQALPFS-ITDRLTELTHFLYEQLLT 310
gi 13431405  236 KREVLEQMEPFLYGGEMIDRVSLEDVTFNELPYKFEAGTPNIADIVASREALRYLKETGFDSVHEKIEQLTQMALKEMMK 315
gi 13431390  246 RRELLAQMPPFLTGGSMIETVTMEGATYAPAPQRFEAGTPMTSQVVGLAAAARYLGAIGMAAVEAHERELVAAAIEGLSG 325
gi 13431388  237 KKALLENMEPAEFGGEMIDFVGLYESTWKELPWKFEAGTPIIAGAIGLGAAIDFLEEIGLDEISRHEHKLAAYALERFRQ 316
gi 499336783 238 KEDLLDEVPPFLRGGEMIDEVYEEYSTFAPPPLKFEAGTPNVEGAYVLISAIDYLERIGLENIYEHEAKLLEYGLEKINA 317
gi 445932220 239 KEEILEEMPPWMGGGDMIAQVYKEKSTYAELPSKLEAGTPNIAGVIGFGSAIEYLENIGMQEIRNHEIELLSYALNRLDD 318
gi 499269172 236 KEALLEKMPPFMFGGDMIEYVWEQKTTFAEVPHKFEGGTQNVGGAVGLTAAIEYLNKVGLDKVYAIEKELTAYALERLSE 315
gi 13431406  249 RQELLEDLPPFLGGGEMIETVSMHSSTYAPAPHKFEAGTPPVAQAVGLGAAIDYLNSIGMDKILAHEHALTEYAVKRLLE 328
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1T3I_A       324 IPQLRLYGPNPKHgDRAALASFNVAGLHASDVATMVDQD-GIAIRSGHHCTQPLHRLFD-------ASGSARASLYFYNT 395
gi 13431409  316 IPGVEILGPSIEE-PRGALIGMTIDGAHPLDLGFLLDLR-GIAVRTGHQCAQPAMERWN-------VGHVLRVSLGIYND 386
gi 13431392  311 VPGIQIIGPKQGA-ARGSLCSISIPGVQASDLGFLLDGR-GISVRSGHQCSQPAMVRWD-------LGHVLRASLGIYNE 381
gi 13431405  316 IGGVEIYGPLDE--RQHGIVSFNVKGIHPHDVAHILDQEfGIAVRSGHHCAQPLMSILKeqsqidfPNSTCRASFYIYNT 393
gi 13431390  326 IDGVRILGPTSMR-DRGSPVAFVVEGVHAHDVGQVLDDG-GVAVRVGHHCALPLHRRFG-------LAATARASFAVYNT 396
gi 13431388  317 LDGVTVYGPE----ERAGLVTFNLDDVHPHDVATVLDAE-GIAVRAGHHCAQPLMKWLD-------VTATARASFYLYNT 384
gi 499336783 318 LEYVKTYGPMDSK-DRGGIISFNVEGVHPHDVATILDEE-GIAVRSGHHCCQPLMRYLG-------VPATVRASFYLYND 388
gi 445932220 319 FGGLELYGTRDLS-KRGGVISFNFPGVHPHDVGTILDEE-GIAIRVGHHCAQPFMAFQN-------IPGTCRASLYLYNT 389
gi 499269172 316 LPYVKVYGTKDAS-KKAGVISFNVDDVHPHDVATILDSY-GVAIRTGHHCANPLMRYMD-------VNATCRASFYFYNT 386
gi 13431406  329 VPDLRIIGPTTAE-ERGAAISFTLGDIHPHDVGQVLDEQ-GIAVRVGHHCARPVCLRYG-------IPATTRASFYLYST 399
                        410
                 ....*....|....*....
1T3I_A       396 KEEIDLFLQSLQATIRFFS 414
gi 13431409  387 EDDIDQFILVLQDSLDKIR 405
gi 13431392  382 QQDILLFVEALKDILRAYR 400
gi 13431405  394 EEDVKILVEGVKKVKEWFS 412
gi 13431390  397 ADEVDRLVAGVRRSRHFFG 415
gi 13431388  385 EEEIDKLVEALQKTKEYFT 403
gi 499336783 389 FDDIDALVEALKKVRKWFK 407
gi 445932220 390 KDDIDRLIQGLIKVKEIFS 408
gi 499269172 387 REDVDALVEGLKNTRKWLG 405
gi 13431406  400 PAEIDALVDGLEHVRNFFG 418
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap