Conserved Protein Domain Family
PTS-II-BC-sucr

?
TIGR01996: PTS-II-BC-sucr 
PTS system, sucrose-specific IIBC component
This model represents the fused enzyme II B and C components of the sucrose-specific PTS sugar transporter system. Sucrose is converted to sucrose-6-phosphate in the process of translocation into the cell. Some of these transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci, Streptococci, Lactococci, Lactobacilli, etc. which contain their own A domain as a C-terminal fusion. This family is closely related to the trehalose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively).
Statistics
?
PSSM-Id: 131051
View PSSM: TIGR01996
Aligned: 15 rows
Threshold Bit Score: 563.847
Threshold Setting Gi: 4091870
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28269956    2 NHQEVADRVLNAIG-KNNIQAAAHCATRLRLVIKDESKIDQQALDDDADVKGTFETNGQYQIIIGPGDVDKVYDALIAKT 80
gi 47926       2 DFEQISCSLLPLLGgKENIAS-AALATRLRLVLVDDSLADQQAIGKVEGVKGCFRNAGQMQIIFGTGVVNKVYAAFTQAA 80
gi 134179      1 MHKEIAKELLLLAGgKNNIISISHCTTRLRFDVKDETKIDIHAIENLQGVQGTFFRYGLFQIIFGAGVVNKIYKEVVHVW 80
gi 4091870     2 KEQIVAKEILENIGgKENIKSVEHCATRLRLILNDKEKINEKAIENIDGVKGQFFSAAQYQIILGTGFVNEVYDVIVGQ- 80
gi 447030860   2 NYKQSAEDILNAIGgEENLDAMAHCATRLRLVLNDESLVNEEALNNMDVVKGTFSTGGQYQIIIGSGTVNKVFSELEKLT 81
gi 516666915   2 DNKQIAKEVIEALGgRDNVRSVAHCATRLRVMVVDEAKIDKERAENIDKVKGAFFNSGQYQIIFGTGTVNKIYDEVVDL- 80
gi 499266352   2 DYNKTAKDILKLLGgEKNVMSAAHCATRLRLVLKNEKEARTKEIEKLDGVKGVFSSSGQYQIIIGQGSVNKVYKAFVEGT 81
gi 499200477   2 NHQEVVKQLIPLLGgRENIVSGTHCATRLRIVLKDDQLAQTKEIEQLDGVKGAFLSSGQYQIIFGTGVVNKVYAAFAEET 81
gi 515097042  17 NEQETAQALLPLLGgPDNVVSLAHCATRLRLVVRDAAKVDHGAITALALVKGAFSNAGQVQIVIGQGTVNRVHDALQPLL 96
gi 499225084   2 DNRQIAAEVIEALGgRENVRSVAHCATRLRVMVYDEGKIDKEKAEAIDKVKGAFFNSGQYQMIFGTGTVNNIYDEVVAL- 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28269956   81 G-LKEATPDDIKAVAAAgqKKNPLMDFLKVLSDIFIPIVPALVAGGLLMALNNVLTAEHLFMAk-SVVEVYPGLKGIAEM 158
gi 47926      81 G-ISESSKSEAADIAAK--KLNPFQRIARLLSNIFVPIIPAIVASGLLMGLLGMVKTYGWVDP-------G---NAIYIM 147
gi 134179     81 E-TAPSEEPVHQKKASR--KLNPAAAFAKTLSDIFVPIIPAITASGLLMGLIGMIKVFHWFAA-------G---SPWIKM 147
gi 4091870    81 --NSDLVTGNNKEEAYs--QMTLIQKISRTFGDVFVPIIPVLVATGLFMGLRGLLTN--------LGVQ---MNENFVLF 145
gi 447030860  82 G-KEASTTSEVKAQSAK--NMNPLQRFVKMLSDIFVPIIPAIVAGGLLMGLNNILTAKDLFFSgkSLIDVYSQFAGLAEM 158
gi 516666915  81 G-LPTSSTGEQKQEAAA--QGNWFQRMSRTFGDVFVPIIPVLVATGLFMGLRGLLTNDTFLGF--FGASSKDINANFILY 155
gi 499266352  82 G-ISESSLSDTKKAAMK--NMNLFERFARMLSNIFVPIIPAIVASGLLMGLLGMLDAFHLVNS--K--------SGLYVI 148
gi 499200477  82 G-LKEGNQEDHQEAVKK--KMNPIARFAKTLSNIFVPIIPAIVASGLLMGLLGMMRTFEWVAP----------DHALIVL 148
gi 515097042  97 NsTAAASLEDVKREATT--RLNPVQRLARTLSDIFVPIIPVIVASGLLMGVLGMLRSMGWAEG--S--------NALFQI 164
gi 499225084  81 G-LPTSSTSEQKAEAGK--HGNIFQRAIRTFGDVFVPIIPAIVATGLFMGVRGLVTQPAIMDL--FGVH--EYGENFLMY 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28269956  159 INAMASAPFTFLPILLGFSATKRFGGNPYLGATMGMIMVLPSLVNGYSVATTMAAGKMv-yWNVFGLHVAQAGYQGQVLP 237
gi 47926     148 LDMCSSAAFIILPILIGFTAAREFGGNPYLGATLGGILTHPALTNAWGVAAGFHT------MNFFGFEIAMIGYQGTVFP 221
gi 134179    148 LDLVSSTAFILLPILVGFSAARQFGSNPYLGAVIAGLLTHPDLLDPSMLGSKTPSS-----LDIWGLHIPMMGYQGSMIP 222
gi 4091870   146 TQVLTDTAFAFLPALVAWSTMKKFGGTPVIGIVIGLMLVSPSLPNAYAVAAGTATPIN---LTILGLNIPVVGYQGSVLP 222
gi 447030860 159 INVFANAPFTLLPILIGFSAAKRFGGNPFLGAVLGMILVHPSLMSAYDFPKAVEAGKAipyWDVFGLHINQVGYQGQVLP 238
gi 516666915 156 TQVLTDTAFAFLPALIAWSSFKVFGGNPVLGIVLGLMMVNPALPNAYAVASGDA--KA---LTFFGF-IPVVGYQGTVLP 229
gi 499266352 149 LNMFSNAAFQFLPMIIAFSAAREFKTNPYLAAALGAIMIHPDLQNAWTLGEGIKHT-----INIFGLNIGMVGYQGTVLP 223
gi 499200477 149 LDMFSSAAFIILPILIGVSAAKEFGGNPYLGAVMGGIMTHPALLNPWGLGNAEPDY-----LTFLGFDIALIGYQGTVIP 223
gi 515097042 165 FDIFASTAFVFLPILIAFSAGKSFGVSPFLAAALAGILIHPALQNAWTLGSGVREY-----WDLFGVPVAKVGYQGTVLP 239
gi 499225084 154 TRILTDTAFVYLPALVAWSAFRVFGGNPIIGIVLGLMLVSNELPNAWVVASGGDV-KP---LTFFGF-VPVVGYQGTVLP 228
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28269956  238 VLAVAYILATLEKFFHKHIKGAFDFTFTPMFAIVITGFLTFTIVGPVLRTVSDALTNGLVGLYNTTGWIGMGIFGLLYSA 317
gi 47926     222 VLLAVWFMSIVEKQLRRAIPDALDLILTPFLTVIISGFIALLIIGPAGRALGDGISFVLSTLISHAGWLAGLLFGGLYSV 301
gi 134179    223 ILLSVFVMSKIEKLLKSIVPKSLDVVIIPFITVMVTGCLALIVMNPAASIIGQIMTQSIVYIYDHAGIAAGALFGGIYST 302
gi 4091870   223 ALVLGIIAAKTQKALKKVVPDVLDLIVTPFITLLFSMVLGLLIVGPIMHNAEQLIFGAIKGFMGLPFGLGGLVVGGVHQL 302
gi 447030860 239 MLVAAYILASIEKGLRKVIPTVLDNLLTPLLSIFITAFLTFSFVGPITRQLGYWLSDGLTWLYEFGGAIGGLIFGLLYAP 318
gi 516666915 230 AFFVGMIGARLENWLHKRVPEALDLLITPFLTFLVMSILGLFAIGPVFHSVETVVLAATEWILALPFGIAGIIIGGLQQV 309
gi 499266352 224 ILISVWVMSYIEKGLRKIVPEALDILLTPFLTLMITGFFAMVVIGPGGRFVGDEISLGLQTLYNTTGFFSGVLFGGLYSL 303
gi 499200477 224 VLLAVYAMSKIEKGLRKVVPNAIDLLVTPFVTIMLTGFISLMVIGPIGNFIGDGITTILNFVYDHVGFVAGLLFGGIYSA 303
gi 515097042 240 VLFAVWIMARIERLVRRVVPTGVDLIFTPFLTLLISGAIALTVVGPIGRALGDALSFGLQWVYQHGGPLAGLVFGGLYSA 319
gi 499225084 229 AFFVGLVGAKLEKWLHKKVPEALDLLVTPFLTFAIMSTLGLFVIGPVFHSLENLVLAGTQAVLHLPFGIAGLIVGGIQQL 308
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28269956  318 IVITGLHQTFPAIETQLLAN-VAkTGGSFIFPVASMANIGQGAATLAIFFATK-SQKQKALTSSAGVSALLGITEPAIFG 395
gi 47926     302 IVITGIHHSFHAVEAGLLGN-PS-IGVNFLLPIWAMANVAQGGACLAVWFKTK-DAKIKAITLPSAFSAMLGITEAAIFG 378
gi 134179    303 IVLSGLHHSFYAIEATLLAN-PH-VGVNFLVPIWSMANVAQGGAGLAVFLKTK-QSSLKKIALPASLTAFLGIVEPIVFG 379
gi 4091870   303 IVVTGVHHALNALEVELLSS-TG---KDAFNAMITCGIVAQGAAALAVAVKTK-DKKKRSLYISSAIPAFLGITEPAIFG 377
gi 447030860 319 IVITGMHHSFIAVETTLIADaTK-TGGSFIFPIATMSNVAQGGAAIAAFFIIKqNKKLKGVASAAGISALLGITEPAMFG 397
gi 516666915 310 IVVTGVHHIFNFLETQLLAE-TK---ANPFNPLLSAATAGQVGAVLAVAVKTK-SAKLKALAYPSALSAALGITEPAIFG 384
gi 499266352 304 IVITGIHHSFHAIEAGLLAN-PA-IHKNFLLPIWSMANVAQGGAALAVYFKTR-DKKMKSIAAPASFSCLLGITEPAIFG 380
gi 499200477 304 IVITGVHHSFHAIEAGLIAS----IGINYLLPIWSMANVAQGGAGLAVFFKTK-RAKTKEVALPSAFSAFLGITEPVIFG 378
gi 515097042 320 IVVTGVHHSFHAIEAGLLAN-PS-IGVNFLLPIWSMANIAQGGAALAVFSVSR-DDKIRQIALPAALSCLMGITEAAIFG 396
gi 499225084 309 IVVTGIHHIFNFLEAQLIAN-T---GKDPFNAYLTAATAAQAGATLAVAVKTK-STKLKGLAFPSTLSALLGITEPAIFG 383
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 28269956  396 VNLKMKFPFVFAAIASGIASAFLGLFHVLSVAMGPASVIGFISIASKS-IP--AFMLSAVISFVVAFIPTFIY 465
gi 47926     379 INLRFVKPFIAALIGGAAGGAWVVSVHVYMTAVGLTAIPGMAIVQAS---SllNYIIGMVMPLASPLRCSLVL 448
gi 134179    380 VNLKLIRPFIGAAIGGAIGGAYVVAVQVVANSYGLTGIPMISIVLPFGaANfvHYMIGFLIAAVSAFIATLFL 452
gi 4091870   378 VNLRFIKPFIFGCAGGAVGGMLSGILHLAGTGMGITALPGMLLYVN----NlgSYILVNVVAIAVAFCLTLFF 446
gi 447030860 398 VNLKLRYPFIGAIVGSGIGSAYIAFFKVKAIALGTAGLPGFISINPVH-AGwlHYFVGMTISFIIAITVTLIL 469
gi 516666915 385 VNLRYGKPFVMGLVGGSAGGFIAALVGLKATGMSVTVLPGLLLFLNS---QmpMYIVSITVACAIAFALTYYF 454
gi 499266352 381 VNLRYTKPFIAGALGGAIGGGYIVFTKVAMTAVGVTGIPGIAIVKQG---SflNYIIAMILAFGGAFIIAMVL 450
gi 499200477 379 VNLKYRRPFVGAMIGGALGGAYVVFMNVSAVAYGLTGIPMLAIVSPLGtINllHYVIGFFIALVTAFVATWLL 451
gi 515097042 397 INLRFFRPFIAAAVGGAVAGGWVVATHVGMTGIALTGFPGLAIVQPG---SlvNYLIGAGIAFSVAFVCARLa 466
gi 499225084 384 VNLRYPKVFVSGLIGGALGGWVAGLFGIAGTGFGITVLPGTLLYLNG---QllQYLVTMLVGLGVAFAIAYTW 453
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap