Conserved Protein Domain Family
PTS-II-BC-unk1

?
TIGR02003: PTS-II-BC-unk1 
PTS system, IIBC component
This model represents a family of fused B and C components of PTS enzyme II. This clade is a member of a larger family which contains enzyme II's specific for a variety of sugars including glucose (TIGR02002) and N-acetylglucosamine (TIGR01998). None of the members of this clade have been experimentally characterized. This clade includes sequences from Streptococcus and Enterococcus which also include a C-terminal A domain as well as Bacillus and Clostridium which do not. In nearly all cases, these species also contain an authentic glucose-specific PTS transporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 131058
View PSSM: TIGR02003
Aligned: 2 rows
Threshold Bit Score: 966.735
Threshold Setting Gi: 29894163
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29894163    2 KITSFDFWQKFGKALLVVVAVMPAAGLMISIGKLIGMSAGDVNAVHTIARVMEDIGWAIITNLHILFAVAIGGSWAKDRA 81
gi 499327765   7 QLFRFEFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMINHDSAFLASLGNIIAQIGWAVIVNLHLLFALAIGGSWAKERA 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29894163   82 GGAFAALLAFVLTNRITGAIFGVNAEMLADSKAKVSSVIAGDLIVKDYFTSVLGAPALNMGVFVGIITGFLGATLYNRYY 161
gi 499327765  87 GGAFASGLAFVLINRITGAFYGVSSAMLADPEAKITSFLGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYNKYY 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29894163  162 NYDRLPQALAFFNGKRFVPFVVILWSTVTAIVLSLLWPFIQSGLNEFGRWIAASKDSAPVVAPFVYGTLERLLLPFGLHH 241
gi 499327765 167 NYRKLPEVLTFFNGKRFVPFVVILRSIFVALILVVVWPVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHH 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29894163  242 MLTIPMNYTELGGTYTMLTGSKVGQVVAGQDPLWLAWITDLNNLLANgDTKAYNDLLNNVVPARFKAGQVIGSTAALMGI 321
gi 499327765 247 MLTIPMNYTALGGTYEVMTGAAAGTKVFGQDPLWLAWVTDLVHLKGS-DASAYSHLMDSVTPARFKVGQMIGATGTLMGI 325
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29894163  322 AFAMFRNVDKEKRAKYKPMFLSAALAVFLTGVTEPIEFMFMFIAPVLYVVYAITTGLAFALADLINLRVHAFGFIELITR 401
gi 499327765 326 ALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYLFMFAAMPLYIVYALVQGASFAMADLVNLRVHSFGNIELLTR 405
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29894163  402 TPMMVNAGLTRDLINFVIVSLVFFGLNFTLFNFLIKKFNLPTPGRAGNY-IDNEDE-ASEGTGNVQD--GSLATKVIDLL 477
gi 499327765 406 TPMALKAGLGMDVINFVWVSILFAVIMYFIADMMIKKMHLATAGRLGNYdADILGDrNTQARPTQVAdsNSQVVQIINLL 485
                        490       500       510       520       530       540
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 29894163  478 GGKENIADVDACMTRLRVTVKDLDVVAPEAQWKQNGALGLIVKDKGVQAVYGPKADVLKSDIQDMLGA 545
gi 499327765 486 GGAGNIDDVDACMTRLRVTVKDPAKVGAEDDWKKADAMGLIQKGNGVQAVYGPKADVLKSDIQDLLDS 553
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap