1I7H,3AH7


Conserved Protein Domain Family
fdx_isc

?
TIGR02007: fdx_isc 
Click on image for an interactive view with Cn3D
ferredoxin, 2Fe-2S type, ISC system
This family consists of proteobacterial ferredoxins associated with and essential to the ISC system of 2Fe-2S cluster assembly. This family is closely related to (but excludes) eukaryotic (mitochondrial) adrenodoxins, which are ferredoxins involved in electron transfer to P450 cytochromes. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131062
View PSSM: TIGR02007
Aligned: 7 rows
Threshold Bit Score: 178.831
Threshold Setting Gi: 329665907
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1I7H_A         2 PKIVILPHQDLCPDGAVLEANS-GETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLE 80
gi 119999      2 PKIVILPHQDLCPDGAVLEANS-GETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLE 80
gi 4033381     2 PKIFFLPHKLLLPKGGCFECKE-GETILNVALKNNIKLEHACEKSCACSTCHCIIRKGFLSLSGWSEKEEDVLDKAWGLE 80
gi 1169674     2 PKVIFLPNEDFCPEGMVVDAAT-GDNLLEVAHNAGVEIHHACDGSCACTTCHVIVREGFDSLNETSDQEEDMLDKAWGLE 80
gi 499310202   2 PQIVVLPHVEYCPEGAVIEAKP-GTSICDALLGAHIEIEHACEKSCACTTCHVIVREGFDSLGEATEKEEDLLDKAWGLE 80
gi 488146001   2 PKITVLPHTTLCPEGAVIDNAPeGKTVLDVLLDHDIEVDHACEKSCACTTCHVIIRKGFDSLEEPTELEEDLLDQAWGLE 81
3AH7_A         2 PLVTFLPHEKFCPEGLTVEVKP-GTNILELAHDHHIEMESACGGVKACTTCHCIVRKGFDSLEEADELEEDMLDKAWGLE 80
                         90       100       110
                 ....*....|....*....|....*....|.
1I7H_A        81 PESRLSCQARVTDEDLVVEIPRYTINHAREH 111
gi 119999     81 PESRLSCQARVTDEDLVVEIPRYTINHAREH 111
gi 4033381    81 STSRLSCQAIIGNIDIEVQIPLYNTNYIIEN 111
gi 1169674    81 MDSRLSCQCVVGNEDLVVEIPKYNLNHANEA 111
gi 499310202  81 PNSRLSCQAKVADEDLTVEIPKYSINHAKET 111
gi 488146001  82 ADSRLSCQAVVAGEDLIVEIPKYTINHAREE 112
3AH7_A        81 AQSRLGCQVFVADEDLTIEIPKYSLNHAAEA 111
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap