Conserved Protein Domain Family
BchJ

?
TIGR02019: BchJ 
bacteriochlorophyll 4-vinyl reductase
This model represents the component of bacteriochlorophyll synthetase responsible for reduction of the B-ring pendant ethylene (4-vinyl) group. It appears that this step must precede the reduction of ring D, at least by the "dark" protochlorophyllide reductase enzymes BchN, BchB and BchL. This family appears to be present in photosynthetic bacteria except for the cyanobacterial clade. Cyanobacteria must use a non-orthologous gene to carry out this required step for the biosynthesis of both bacteriochlorophyll and chlorophyll. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 131074
View PSSM: TIGR02019
Aligned: 3 rows
Threshold Bit Score: 272.141
Threshold Setting Gi: 14194483
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10198135    9 RIGPNSIIQTVAAARAQYGEEAVADWLRRTGrgHLLEAMPDHMLPESEFGDLIADLRFWLGVsAAADVLAQSGDLTAQYV 88
gi 14194483   17 RIGPNAILQLIPVLEAAFGPGAADRALAAAG--VPRPGPESGMLPETQVSTLHRWLRDTHPE-EAPRLLREAGLATGDYI 93
gi 499236130   7 RIGPNSIIQTVGALETAYGKNETEKLLKKIGqgYLINNLPSEMVEESKFHALVTALQKELGEtATAGILKESGERTAKYL 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10198135   89 ATHRVPVPIRWLLPRLPVGLALRIFLPAIARHAWTFAGSGRFGYTLQPAWRLTLADSVEARGVRATEPVCA-YYRAAFEG 167
gi 14194483   94 LANRIPPLAQRLIRALPAFLGARVLATAIAKHSWTFAGSGKFRVVSGRPLSFEIARNPVVAGESSDTPLCH-WHAAVFER 172
gi 499236130  87 LKVRIPGPFQTIVKLLPAGLAFKVLLFAISKNAWTFAGSGEFSYGSKPSPNVMVKVTFP------SHPVVSnFYLGTFTA 160
                        170       180
                 ....*....|....*....|....*....
gi 10198135  168 LLRRVVCDRLRVHEVACRAMGTGRCEFAV 196
gi 14194483  173 LFSRLVWPHVAVRETACCAKGAPACRFEL 201
gi 499236130 161 LLRELVSPKTEIKADIRKEGSAIRCNYLC 189
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap