Conserved Protein Domain Family
BchF

?
TIGR02020: BchF 
2-vinyl bacteriochlorophyllide hydratase
This model represents the enzyme responsible for the first step in the modification of the ring A vinyl group of chlorophyllide a which (in part) distinguishes chlorophyll from bacteriochlorophyll. This enzyme is aparrently absent from cyanobacteria (which do not use bacteriochlorophyll). [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 131075
View PSSM: TIGR02020
Aligned: 4 rows
Threshold Bit Score: 196.956
Threshold Setting Gi: 21674242
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18645071   36 FYTPEQRLRRDSSVWTTVQGVLAPLQFLAFALSLVFVINFLA--NGTGYSAAVISVLIKTLFLFTIMVTGAIWEKVVFGR 113
gi 4586904    39 LYSIEERRRRDATKWTLVQGILAPIQFVVFLVSLSLVAHYLI--TGNGLALATDSILVKTIVLFTIMITGAIWEHEVFGK 116
gi 499235896  36 RYTPEQLAKRNASVWTDIQIILAPIQFFIFLGGITLNTLYYFnlAGIDFYWISIAILFKTLFFAILFITGMFFEKEIFNH 115
gi 499235548   3 RYTPEQLEKRNASKWTTVQAILAPIQFLIFLAGLTVTYLYSQgiWVTDFWWVTFFVALKTFMLVLIFVTGGFFELEVFGK 82
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 18645071  114 YLFAPAFFWEDVVSMLVIFLHVAYVVSWLFDLQAPREQMWLAIAAYTAYVINAAQFLLKLRAARV 178
gi 4586904   117 YLFARAFFWEDLFSMLVIALHSLYVLVLFTHIAGPQTQMMIALAAYATYLINAMQFIMKLRAARL 181
gi 499235896 116 WIYSKEFLWEDVGSTVAAFFHLLYFVMA-WMEYPEHVLVVEAYIAYLTYVLNALQYLVRIILEKN 179
gi 499235548  83 FAFAHEFFWEDFGSAIAMIVHISYFILFFWIKPAEHILILTAYLAYLSYLVNAAQFVIRLLLEKH 147
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap