1TT9


Conserved Protein Domain Family
FtcD

?
TIGR02024: FtcD 
Click on image for an interactive view with Cn3D
glutamate formiminotransferase
This model represents the tetrahydrofolate (THF) dependent glutamate formiminotransferase involved in the histidine utilization pathway. This enzyme interconverts L-glutamate and N-formimino-L-glutamate. The enzyme is bifunctional as it also catalyzes the cyclodeaminase reaction on N-formimino-THF, converting it to 5,10-methenyl-THF and releasing ammonia - part of the process of regenerating THF. This model covers enzymes from metazoa as well as gram-positive bacteria and archaea. In humans, deficiency of this enzyme results in a disease phenotype. The crystal structure of the enzyme has been studied in the context of the catalytic mechanism. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 131079
View PSSM: TIGR02024
Aligned: 6 rows
Threshold Bit Score: 492.737
Threshold Setting Gi: 16082441
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TT9_A         1 MSQLVECVPNFSEGNNQEVIDAISQAISQTPGCVLLDVDAGPSTNRTVYTFVGQPECVVEGALSAARTASQLIDXRKHKG 80
gi 28204345    1 MARLVECVPNFSEGKDKKIIETIVDEVRKIENVKLLDYSSDEDHNRSVVTMIGDPEDVKKAVLGLAKKSIELIDMTKHHG 80
gi 490182171   1 -MKLIESVPNFSEGRRKEVVEKIVAEAKKYDRVWVLDWSMDADHNRSVITLVGEPENLINALFDMTKKAAELIDLRNHTG 79
gi 499204336   1 -MSLVECVPNFSEGRDRDRVNRIRDAIASVDTVKILDVEMDPNHNRSVITFVCDSSKAVDAAFAGIKAAAEIIDMDAHRG 79
gi 8134464     1 MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQG 80
gi 492611610   1 MNKILMAEVNISEGTNLELIEKVKKSFIDEKNIEIVDIDSNVDHNRTVFTYKGEPSAVLNATKKLAKCAVDLIDMRNHKG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TT9_A        81 EHPRXGALDVCPFIPVRGVSXDECVLCAKAFGQRLAeELNVPVYLYGEAAQXPSRQTLPAIRAG--EYEALPEKLKQAEW 158
gi 28204345   81 GHPRMGAVDVIPFTPVSDVTMEECVELANEVGKEIG-SLGVPVYLYEDAATTPERQNLAKVRKG--QYEGFFEKIKESEW 157
gi 490182171  80 QHPRMGAADVIPLVPLYNTTMEECVEYSKILGRRIGeELGIPVYLYEKSATRPERQNLADIRKG--EFEGFFEKIKDPLW 157
gi 499204336  80 EHPRFGAADVIPFVPLQDTKMETCVRLARDLGKRVGeELGIPVYLYAEAAQRPDRSDLAAIRNKnfQYEQLKEAIKEEKW 159
gi 8134464    81 EHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAeELDVPVYLYGEAARMDSRRTLPAIRAG--EYEALPKKLQQADW 158
gi 492611610  81 SHPRMGAVDVVPFIPVKNITTEEAVEIAKEFGKYLG-EQGVPVYFYEDAQEKEYRKTLPSIRKG--QYEALEEKMKDPKW 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TT9_A       159 VPDFGPSSFVPSWGATVTGARKFLIAFNINL-LSTKEQAHRIALNLREQGRGkdqpgrLKKVQGIGWYLEEKNLAQVSTN 237
gi 28204345  158 KPDYGPQEMNAKSGCTAVGARVALVAFNVNLgTDNLEVADAIAKKVRFIGGG------LRFAKAIGLKLEERNIVQVSMN 231
gi 490182171 158 KPDFGPDRVHPTAGVTAVGAREFLIAFNVNLgTRDVKIAEKIARAIRFSSGG------LRYVKAIGVDLKGRGVVQVSIN 231
gi 499204336 160 KPDFGPSVVG-KAGASIIGARDFLIAYNVNLnTSNMEIGKKIASAIRAKDGG------LTFVKSLAFFLKDKNMVQISMN 232
gi 8134464   159 APDFGPSSFVPSWGATATGARKFLIAFNINL-LGTKEQAHRIALNLREQGRGkdqpgrLKKVQGIGWYLDEKNLAQVSTN 237
gi 492611610 158 APDEGPKEFNPKSGGTVTGARFPLVAFNINLdTYNLEIGKKIVKAVRSATGG------YSCIRAIALELEEKKQIQVSMN 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TT9_A       238 LLDFEVTALHTVYEEARREAQELNLPVVGSQLVGLVPLKALLDAAAFYCDkeklfvleeehrirlvvnrlgLDSlapFDP 317
gi 28204345  232 LVNYEKTSVYRAFEMIKMEAKRYGVPVVGSEVIGTVPMKALLDCAEYYLQ---------------------IEN---FDI 287
gi 490182171 232 ITNHKKTPLYRVFELIKMEAERYGVPVLGSEIVGLFPLESLLKTVSYYLR---------------------TD----LNA 286
gi 499204336 233 LTNYRKTPIYRAYELVRLEAARYGVLPVESEIVGLVPEQALIDVAKYYLQ---------------------LNG---FDE 288
gi 8134464   238 LLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEkenlfileeeqrirlvvsrlgLDSlcpFSP 317
gi 492611610 232 MINYEKTPIHRVFETIKSEANRYNVNIVDTELVGPVPIYALRDVLDFYLRi--------------------ADS---FSL 288
                        330
                 ....*....|.
1TT9_A       318 KeRIIEYLVPD 328
gi 28204345  288 S-QILEKRLLD 297
gi 490182171 287 K-KVIESNLLE 296
gi 499204336 289 G-NILERKMEK 298
gi 8134464   318 KeRIIEYLVPE 328
gi 492611610 289 D-QIYF----- 293
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap