Conserved Protein Domain Family
BchE

?
TIGR02026: BchE 
magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase
This model represents the cobalamin-dependent oxidative cyclase, a radical SAM enzyme responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions. This step is essential in the biosynthesis of both bacteriochlorophyll and chlorophyll under anaerobic conditions (a separate enzyme, AcsF, acts under aerobic conditions). This model identifies two clades of sequences, one from photosynthetic, non-cyanobacterial bacteria and another including Synechocystis and several non-photosynthetic bacteria. The function of the Synechocystis gene is supported by gene clustering with other photosynthetic genes, so the purpose of the gene in the non-photosynthetic bacteria is uncertain. Note that homologs of this gene are not found in plants which rely solely on the aerobic cyclase.
Statistics
?
PSSM-Id: 131081
View PSSM: TIGR02026
Aligned: 3 rows
Threshold Bit Score: 795.269
Threshold Setting Gi: 16331659
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85681289    2 RIVFVHPNYHSGGAEIAG-SWPPAWVAYLCGALKKAGYTDYHFIDAMTDYVSHEKLAEKLRELQPDIVAT--TAITPSIY 78
gi 10198136    2 RIMMIQPNYHAGGAEIAG-NWPPSWVAYIGGALRAAGFDNLRFVDAMTEDLPDEKLRLILRHNRPDVVMA--TAITPMIY 78
gi 499176097   2 RILILNPPHPAIGSRIPKeQLPPLGLLSIGGPLLDAG-HDVTLLDAEFGPLTDSEIVERVCAHCPQLLLIghSGSTSAHP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85681289   79 VAEETLKVAMEVVPNALRVLGGIHATFMFRQVLEEAPWIDVIVRGEGEEVLVNLVKAYEADNFAETRRQVKGLAFLDG-D 157
gi 10198136   79 KAQETLKIAREELPNARLILGGIHPTFMYGQVLTEAPWIDYIVRGEGEEIIVELMQAIAYGSDQRDRVKIRGIAYLED-G 157
gi 499176097  81 IVCRLTLFLRERLPNLIIVYGGVFPTYHFHDILTKEPQIDFIVRGEGEATVAKLIAALENHN---DLNKVDGIAFRRDeQ 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85681289  158 EIVSTAAAPTIRDVDSIDPDWGIINWKNYIYEPLGVRVAIPNMARGCPFTCSFCSQWKFWRDYRVRDPKKVVDEIEKLVN 237
gi 10198136  158 KVVATPARDPIADLDKLTPDWSLYDWKRYIYVPLNVRVAVPNFARGCPFTCRFCSQWKFWRRYRARSPQKFVDEIETLVR 237
gi 499176097 158 -IIETLPAPMIQDLDVYRVGWELVDLKKYSYYG-GKQAVVIQFSRGCPHLCNYCGQRGFWARWRHRDPKKFAQEIVWLHR 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85681289  238 EHGVGFFILADEEPTINRKKFIEFCEEMIARglPDKVKWGINTRVTDVKRDKELLKFYRKAGLVHISLGTEAAAQLKLDV 317
gi 10198136  238 DYNVGFFILADEEPTINRKKFTALCEELIRR--QVRVYWGINTRVTDILRDEAQLPLWRAAGLVHISLGTEAAAQMNLDR 315
gi 499176097 236 THGVQLFNLADENPTVNKAIWQEFCEAIIAEn--ISITIIGSTRADDIVRDADILHLYRRAGVERFLLGMENTNEATLKH 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85681289  318 FNKETTVAENKEAIRLLREADIFTEAQFIVGLDNETKETLEETYRMAWDWQPDLANWSMYTPWPFTPLFQELRDQVEVF- 396
gi 10198136  316 FRKQTTIEQNKRAIELIKKHGMVAEAQFIMGMENETPETIEETYRYVLDWKPDMANWNMYTPWPFAELFEELGDRVEVR- 394
gi 499176097 314 IRKGSKTSTDREAIRLLRQHNILSLATWVTDFEEVRDRDFIQALKQLLYYDPDQIMSLYVTPHRWTSFYGIASERRVIQl 393
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85681289  397 DYSKYNFVTPIMKPKALTRGELLDGVMNNYRRFYMK-KALFHYPWRGTGFRRRYLLGCLKAFLKAGVGRTFYDLGKAGYW 475
gi 10198136  395 DYAKYNFVTPIMKPDLMDREEVLKGVLRNYARFYMR-KAFLEYPFIKDPFKRRYMLGCLRAFMKTTVTRRFYDLGRVHVR 473
gi 499176097 394 DQTKWDYKHQVLAATHMPPWRIFLWVKLIEILLQTRpKALWRLLFQPNKASRRGMY-------------WFTLMGRRVLV 460
                        490       500
                 ....*....|....*....|....*.
gi 85681289  476 GpqSKDKVDFHFDETRKIGNAQMADW 501
gi 10198136  474 G--TQLEIDLGFDESRVLTPEQIAAL 497
gi 499176097 461 H----ELINFFFGDRRVKNGPTLQEF 482
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap