Conserved Protein Domain Family
AcsF

?
TIGR02029: AcsF 
magnesium-protoporphyrin IX monomethyl ester aerobic oxidative cyclase
This model respresents the oxidative cyclase responsible for forming the distinctive E-ring of the chlorin ring system under aerobic conditions. This enzyme is believed to utilize a binuclear iron center and molecular oxygen. There are two isoforms of this enzyme in some plants and cyanobacterai which are differentially regulated based on the levels of copper and oxygen. This step is essential in the biosynthesis of both bacteriochlorophyll and chlorophyll under aerobic conditions (a separate enzyme, BchE, acts under anaerobic conditions). This enzyme is found in plants, cyanobacteria and other photosynthetic bacteria. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 131084
View PSSM: TIGR02029
Aligned: 4 rows
Threshold Bit Score: 575.981
Threshold Setting Gi: 6911864
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6911864    54 KKGTKKEIQESLLTPRFYTTDFEEMEQlfnteINKNLNEAEFEALLQEFKTDYNQTHFVRNKEFKEAADK-LQGPLRQIF 132
gi 18645079    8 NESTQQALENRLLAPKFYRTDYKAMNT-----LDVSPVRREWDVMMANFEEDKNRAHFKQSIEFDPESLD-VDMDLKRDF 81
gi 21328665   30 EKATEVAMQNTLLTPRFYTTDFAEMDA-----IDVTPVREDWDRLIAQMKSDPNKGHFKKNEDWDNVDWEgMEPALKAEF 104
gi 499304755   7 KPGIKTPSKETVLTPRFYTTDFETAAN-----LDLSAQENELQAMLAEMRADYNRHHFVRDEAFEQSWEH-IDGEARQAF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6911864   133 VEFLERSCTAEFSGFLLYKELGRRLKKTNpvVAEIFSLMSRDEARHAGFLNKGLSDFNLALDLGFLTKARKYTFFKPKFI 212
gi 18645079   82 LDFLVSSITSEYSGCVLYQEIEKNVDNPD--VSKLMRYMARDESRHAGFINRALKQLGVAVDLSVLKQTKEYHYFRPKFI 159
gi 21328665  105 IDFLISSCTAEFSGCVLYKEMKRRGSNED--ITTLFQLMARDEARHAGFINDALREAGVRVNLGFLTQQKKYTYFRPKFI 182
gi 499304755  81 IEYLERSCISEFSGFLLFKELSRKLKNRSpvLAEMFQLMARDEARHAGFLNKAMGDFKLSLDLATVTKTRTYTFFPIEWV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6911864   213 FYATYLSEKIGYWRYITIYRHLKENPEFQCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNdWq-AKLWSRFFCLSVY 291
gi 18645079  160 YYATYLSEKIGYARYITIYRHLQRNPQNQFHPIFNWFERWCNDEYAHGEAFALLMRSDPKLLR-Gh-NKLWIRFFLLAVY 237
gi 21328665  183 YYATYLSEKIGYARYITIYRHLEENPELRFHPIFKWFREWCNDEFSHGEAFALLMKSDPKLTE-SfgNKLWIKFFLTAVY 261
gi 499304755 161 LYTVYLSEKIGYWRYIIIFRHLEKHPENQFYPIFRYFESWCQDENRHGDIFKALLRSQPQLWNnWk-ARLWSRFFLLSVF 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6911864   292 VTMYLNDCQRTNFYEGIGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVVSYEKLLAIGETDDasFIKTL 371
gi 18645079  238 STMYVRDHSRPKLYQAFGMDPTKFDYQVFDITSEISQQVFPMTLNTDDPRFRRGMERLLFLSEKAEGLRAKGG--LINKC 315
gi 21328665  262 STMWVRDHQRPLFHEALGVDVTWYGQEVFRKTSEISKQIFPMTLDIDHPRWRKNLDRMEAASRQIAAAKARGG--LGGMI 339
gi 499304755 240 ATHTLTVHERSGFYKSLGLDATDFDLQVVRNTNETAGRAFPVMLNTEHPKFFPLLQRCAGYNLNISEIERSSQpkFVKLI 319
                        330       340
                 ....*....|....*....|....
gi 6911864   372 KRIPLVTSLASEILAAYLMPPVES 395
gi 18645079  316 LRLGVMAQSGLTFARLYCLPTKPN 339
gi 21328665  340 SRLGGMAKAATAFVLVFTIPAKTH 363
gi 499304755 320 RKLPLIAAIVWNLLMVYLIKPIDT 343
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap