Conserved Protein Domain Family
dsdC

?
TIGR02036: dsdC 
D-serine deaminase transcriptional activator
This family, part of the LysR family of transcriptional regulators, activates transcription of the gene for D-serine deaminase, dsdA. Trusted members of this family so far are found adjacent to dsdA and only in Gammaproteobacteria, including E. coli, Vibrio cholerae, and Colwellia psychrerythraea. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131091
View PSSM: TIGR02036
Aligned: 3 rows
Threshold Bit Score: 598.036
Threshold Setting Gi: 15601631
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506549     8 RNRLLNGWQLSKMHTFEVAARHQSFALAAEELSLSPSAVSHRINQLEEELGIQLFVRSHRKVELTHEGKRVYWALKSSLD 87
gi 499356686  10 NNKRLSSFQLSKMHTFEVAARHCSFSLAAEELSMTPSAISHRINALESELGILLFKRSHRKIELTKEGERIYIAVKSSFS 89
gi 446210261  10 KHSRINSFQLSKLHTFEVAARHNSFSLAADELSLTPSAISHRINKLEEEIGIKLFERTHRKVVLTEEGQRIYHSLQKTLN 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506549    88 TLNQEILDIKNQELSGTLTLYSRPSIAQCWLVPALGDFTRRYPSISLTVLTGNDNVNLQRAGIDLAIYFDDAPSAQLTHH 167
gi 499356686  90 SLNQEILEVKSNEISGELTVYSRPSFAQCWLVPRIAGFQKQYPAISLNILTGNENINFHGHGIDVAIYFDEKQPSKLYCQ 169
gi 446210261  90 NLNQEITDIKNGETSGLLTIYSRPSFAQCWLVPRIHAFKELYPSIDLKLLTGNENISFQGSGIDVAIYFDDHMPDKLSCK 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506549   168 FLMDEEILPVCSPEYAQRHALTNTVINLCHCTLLHDRQAWSNDSGTDEWHSWAQHYAVN-LPTSSGIGFDRSDLAVIAAM 246
gi 499356686 170 DIMTETIVPVCSPEYAEEFDLIGKINNLSQCTLLHDNQAWGYDSNTDEWALWANNFNINcLASSASIRFDRSDLAVIAAM 249
gi 446210261 170 EIFSETIIPVCTPEYAQKYSLTSSMDNLYNTTLLHDNQAWNYNSDADEWKTWANANQLEnLENISRIGFDRSDLAVIAAI 249
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2506549   247 NHIGVAMGRKRLVQKRLASGELVAPFGDMTVKCHQHYYITTLPGRQWPKIEAFIIWLREQVK 308
gi 499356686 250 NNAGVAMGRESFISNQIKRGELIKPFIDKKILCPQRYYVATLPNNKNTKIELFIEWLKNEVQ 311
gi 446210261 250 NNAGIAMGRFSLVKSRLSSGELMTPYPNTEVICKQRYYVATLPNKHNQKVKLFIDWLESQVK 311
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap