Conserved Protein Domain Family
sir

?
TIGR02042: sir 
ferredoxin-sulfite reductase
Distantly related to the iron-sulfur hemoprotein of sulfite reductase (NADPH) found in Proteobacteria and Eubacteria, sulfite reductase (ferredoxin) is a cyanobacterial and plant monomeric enzyme that also catalyzes the reduction of sulfite to sulfide. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 131097
View PSSM: TIGR02042
Aligned: 4 rows
Threshold Bit Score: 1107.99
Threshold Setting Gi: 93141312
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 93141312    5 AAP----QKLSKVEDLKARSQYLLEPILSQLQEESTHFNEDGIQILKFHGSYQQDNRDNRVkgqEKDFQFMLRLRSPGGY 80
gi 3721540    64 AKPaavePKRSKVEIFKEQSNFIRYPLNEEILNDAPNINEAATQLIKFHGSYMQYDRDERG---GRSYSFMLRTKNPGGE 140
gi 804953     66 AKPet-atKRSKVEIIKEKSNFIRYPLNEELLTEAPNVNESAVQLIKFHGSYQQYNREERG---GRSYSFMLRTKNPSGK 141
gi 499304745   5 APPpttgRKPSKVEGLKENSNFLREPVATQILEDTTHFTEDAVQILKFHGSYQQDNRDNRTkgqEKDYQFMLRTKNPGGL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 93141312   81 IPPQLYLTLDQLADDYGNGTLRATTRQAFQLHGILKRDLKTVIRRIVENLGSTISACGDVNRNVMAPPAPFRDRpEYEWA 160
gi 3721540   141 VPNRLYLVMDDLADQFGIGTLRLTTRQTFQLHGVLKKNLKTVMSTIIKNMGSTLGACGDLNRNVLAPAAPFAKK-DYMFA 219
gi 804953    142 VPNQLYLTMDDLADEFGIGTLRLTTRQTFQLHGVLKQNLKTVMSSIIKNMGSTLGACGDLNRNVLAPAAPYVKK-DYLFA 220
gi 499304745  85 VPPQLYLALDKLADEYGNHTLRATTRQGFQMHGILKKNLKAAIATIVRNLGSTLGACGDINRNVMAPPAPFKNRaEYQYA 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 93141312  161 RTYANNIADLLTPESGAYYELWLDGEKVLSGEPdPAVLAARR-NPKG-RVADSVEPLYSDRYLPRKFKIAVTVPGDNSID 238
gi 3721540   220 KQTADNIAALLTPQSGFYYDVWVDGEKVMTAEP-PEVVKARNdNSHGtNFPDSPEPIYGTQFLPRKFKIAVTVPTDNSVD 298
gi 804953    221 QETADNIAALLSPQSGFYYDMWVDGEQFMTAEP-PEVVKARNdNSHGtNFVDSPEPIYGTQFLPRKFKVAVTVPTDNSVD 299
gi 499304745 165 WEYAQNIADLLSPQTGAYYEIWLDGEKAISAEEsPEVKAARQsNGNGtIIHDTEEPLYGTYYMPRKFKVSVTVPGDNSID 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 93141312  239 LFTQDIGLVVIGNDRGELEGFNVYVGGGMGRTHNKEETFARLADPLGFVPAADIYAAVQAIVATQRDYGDRSNRRHARMK 318
gi 3721540   299 IFTNDIGVVVVSNEDGEPQGFNIYVGGGMGRTHRMETTFPRLAEPLGYVPKEDILYAVKAIVVTQRENGRRDDRRYSRLK 378
gi 804953    300 LLTNDIGVVVVSDENGEPQGFNIYVGGGMGRTHRMESTFARLAEPIGYVPKEDILYAVKAIVVTQREHGRRDDRKYSRMK 379
gi 499304745 245 LYSQDLTLVVLTDKKGNLEGFNIFAGGGLGRTHNKEETFARLADPIGYVAKEDVYSAVKAIVATQRDYGDRTDRRHARLK 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 93141312  319 YLIHDWGIAKFKEAVESVFGKAIAPVRELPPFRYRDYLGWHEQGDGKWFLGLPITSGRIKDdgnwQLRSALREIVSRWQL 398
gi 3721540   379 YLLSSWGIEKFRSVTEQYYGKKFQPCRELPEWEFKSYLGWHEAGDGSLFCGLHVDNGRVKG----AMKKALREVIEKYNL 454
gi 804953    380 YLISSWGIEKFRDVVEQYYGKKFEPSRELPEWEFKSYLGWHEQGDGTWFCGLHVDSGRVGG----IMKKTLREVIEKYKI 455
gi 499304745 325 YLINDWGVDKFRAKVEEYFGKPIAPFKQLPEFKYHDFLGWHEQGDGNLFLGISIDNGRVKDegafQLKTALREIVEQFNL 404
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 93141312  399 PLLLTGSQDVLIYDVQPGDRAAIDKLLRDR-GVHTVEAIDSLQRYAMACPALPTCGLAITESERALPGLLVRIRRLLEEQ 477
gi 3721540   455 NVRLTPNQNIILCNIRQAWKRPITTVLAQG-GLLQPRYVDPLNLTAMACPAFPLCPLAITEAERGIPDILKRVRAIFERV 533
gi 804953    456 DVRITPNQNIVLCDIKTEWKRPITTVLAQA-GLLQPEFVDPLNQTAMACPAFPLCPLAITEAERGIPSILKRVRAMFEKV 534
gi 499304745 405 PIRLTPNQNLIFYEITPENKPAIQAILDRCnVVSDPTTIEPLVRYAMACPALPTCGLAITESERAIPGILERIRTLLDKL 484
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 93141312  478 GLP-DEHFVVRMTGCPNGCARPYMAELAFVGSAPNTYQLWLGGSPDQTRLARPFIDRLADGDVETQLRPLFVFFKQSRQA 556
gi 3721540   534 GLKySESVVIRITGCPNGCARPYMAELGLVGDGPNSYQIWLGGTPNQTSLAKTFKDKLKVQDLEKVLEPLFFHWRRKRQS 613
gi 804953    535 GLDyDESVVIRVTGCPNGCARPYMAELGLVGDGPNSYQVWLGGTPNLTQIARSFMDKVKVHDLEKVCEPLFYHWKLERQT 614
gi 499304745 485 GLQ-NEHFVVRMTGCPNGCARPYMAELGFVGSAPESYQVWLGGSPNQTRLAQPYVEKLHDNDIESFLEPIFVYFRKYRKS 563
                        570       580
                 ....*....|....*....|...
gi 93141312  557 GESFGDFCDRVGFDALRQFSESY 579
gi 3721540   614 KESFGDFTNRMGFEKLGEFVEKW 636
gi 804953    615 KESFGEYTTRMGFEKLKELIDTY 637
gi 499304745 564 GESFGDFCDRVGFDAIREFVAEY 586
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap