Conserved Protein Domain Family
ZntR

?
TIGR02043: ZntR 
Zn(II)-responsive transcriptional regulator
This model represents the zinc and cadmium (II) responsive transcriptional activator of the gamma proteobacterial zinc efflux system. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-Cys-X(8-9)-Cys, as well as a conserved and critical cysteine at the N-terminal end of the dimerization helix. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131098
View PSSM: TIGR02043
Aligned: 3 rows
Threshold Bit Score: 217.807
Threshold Setting Gi: 28807920
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28807920    1 MFQIGELAKRCGVTSDTLRFYEKNALIKPAGRSESGYRLYNEENQKQVRFILKAKELGLSLDEIKDLLEIKLEATEHSCA 80
gi 488137807   4 MLKIGQLAKLADVTPDTIRYYEKQGMMDHGERTDGGYRLYTDQDLQRLRFIRYAKQLGFTLDTIAELLSIRIDPDHHTCQ 83
gi 499383228   1 MYRIGELADLCEVKADTLRFYEKHGLLAPSSRTDSGYRVYTDADAARLRFILRAKAVGFTLSEISELLSIDLDKSNWACA 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 28807920   81 EVKAITSAKLELIDEKINELTKIRRALKKINDACCGHTNDdASHCSILAALE 132
gi 488137807  84 ESKSIVDSRLSDVEGKIRELERMRDSLKRLSEACCGTSHA-TTYCSILEALE 134
gi 499383228  81 DVKGMVDLKLAQVQAKIAELLHFQTSLQSLSNACCGGPRS-AEHCSILEALE 131
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap