1Q05


Conserved Protein Domain Family
CueR

?
TIGR02044: CueR 
Click on image for an interactive view with Cn3D
Cu(I)-responsive transcriptional regulator
This model represents the copper-, silver- and gold- (I) responsive transcriptional activator of the gamma proteobacterial copper efflux system. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X7-Cys. This family also lacks a conserved cysteine at the N-terminal end of the dimerization helix which is required for the binding of divalent metals such as zinc; here it is replaced by a serine residue. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131099
View PSSM: TIGR02044
Aligned: 6 rows
Threshold Bit Score: 220.011
Threshold Setting Gi: 17548064
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Q05_A         1 MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNLEESGELVNLFNDPQRHSADV 80
gi 20137819    1 MNISDVAKKTGLTSKAIRFYEEKGLVTPPLRSENGYRTYTQKHLNELTLLRQARQVGFNLEECGELVNLFNDPRRHSADV 80
gi 28808896    1 MNIGAVAKLTGLSSKSIRLYEDKGIISPPARSDSGYREYSDNHIQELNLVSRAKNAGFSLQECKEFVQLAHNPNRKSSEV 80
gi 2394312     1 MNIGQAAKNPVFSSKMIRYYEQIGLIPKAIRTDGGYRDYNDSDVDCFRFISHSRALGFSTEQISTLLVLWNNRERTSADV 80
gi 499312455  15 VNIGEAARASGVSAKMIRYYERIGLLPPSPRTEGNYRVYDPRALHVLRFIHRARSLGFSLEEIRTLLSLWHDRARASADV 94
gi 20138016    1 MNISQIAKLTSLTAKSIRLYEEKGLIIPPLRSESGYRTYTQQHVDDLLLIARCRRVGFSLDECKAMLTLANDPNRTSAAV 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
1Q05_A        81 KRRTLEKVAEIERHIEELQSMRDQLLALANACPGDDSADCPIIENLS 127
gi 20137819   81 KKRTLEKVAEIERHISELQSMRDQLLAMAESCPGDDSADCPIIDNLS 127
gi 28808896   81 KERTMDKLREVEEKIAHLMEIKKQLEGWVSACPGDAKSRCPIIDELT 127
gi 2394312    81 KAIALSHIDELNRKITQLQRMTQTLSHLAQECQGDNNPDCPIIAKLV 127
gi 499312455  95 KAITLRHVADLDARIRELQGMRDTLVTLADACHGDDRPDCPILEGVA 141
gi 20138016   81 RARAQEKWQEISRKLSELTMIKQQLEEWIASCPGDQGSDCPIIEQLK 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap