Conserved Protein Domain Family
P_fruct_ADP

?
TIGR02045: P_fruct_ADP 
ADP-specific phosphofructokinase
Phosphofructokinase is a key enzyme of glycolysis. The phosphate group donor for different subtypes of phosphofructokinase can be ATP, ADP, or pyrophosphate. This family consists of ADP-dependent phosphofructokinases. Members are more similar to ADP-dependent glucokinases (excluded from this family) than to other phosphofructokinases. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 131100
View PSSM: TIGR02045
Aligned: 4 rows
Threshold Bit Score: 714.283
Threshold Setting Gi: 21362623
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21362644  13 SIYTAYNTNVDAIVYLNGETVQRLIDEFGADAVRKRMEDYPREINEPLDFVARLVHALKTGKPMAVPLVN-EELHTWFDS 91
gi 21362622  26 GMFVAYNSNIDAIRHLTEEDLSKLVGFFDESDIQDRVAAYPREIAEPLDFVARLLISMREGKAAEVPAYT-ADIHEWLKE 104
gi 21362646   9 GIYTAYNANVDAIVNLNAEIIQRLIEEFGPDKIKRRLEEYPREINEPLDFVARLVHALKTGKPMAVPLVN-EELHQWFDK 87
gi 21362623  18 KLFTAYNTNVDAIKYLKDEDVQKLVDEFNHKDIIERMEEYPRIIEEPLDFVARLVHSIKTGKPAEVPIKDdKKLHEWFDR 97
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21362644  92 HFRYDVERMGGQAGIIANLLSNLDFREVIVYTPHLAKRQAEMFVRKPNLFYPVVEGGRLVLKHPWEAYREGDPVKVNRIF 171
gi 21362622 105 HLGFDYARMGGQAGIISNLLGRLGLKKVVAYVPWLSEEQAEYFTATGNILHPKVENGKVLLKPPGEAFKPGIGSKVNWIL 184
gi 21362646  88 TFKYDTERIGGQAGIIANILVGLKVKKVIAYTPFLPKRLAELFKEG--ILYPVVEEDKLVLKPIQSAYREGDPLKVNRIF 165
gi 21362623  98 -IKYDEERMGGQAGIVSNLMATLQIDKIIVYTPFLSKKQAEMFVDYDNLLYPLVENGNLVLKKVREAYRD-DPIKINRIF 175
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21362644 172 EFRAGTAFKLGDERIVVPFSGRFIVSARFES-IRIYTEPGLRPFLPEIgERVDGAILSGYQGINLRYSDGKDANYYLRKA 250
gi 21362622 185 EYSKDMNVTCAGNTFKVPRDNRLIISSRPKW-LRLDMDKQIYEQLDTL-LPVDGAMLSGYQMIKEEYEDGSTYKDYVENS 262
gi 21362646 166 EFRKGTRFKLGDEVIEVPHSGRFIVSSRFESiSRIETKDELRKFLPEIgEMVDGAILSGYQGIRLQYSDGKDANYYLRRA 245
gi 21362623 176 EFKKGLKFKLNGEEITAKQSTRFIVASRPEA-LRIEIKDDVRKFLPKIgEAVDCAFLSGYQAIKEEYRDGKTAKYYFERA 254
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21362644 251 KEDIMLLKRE-KDLKVHLEFASIQSRELRKKVIYNLFP-LADSVGMDEAEIAYVLSALGYDELADRIFT--YNRIEDTVL 326
gi 21362622 263 VKVIEKLKSLnPELRIHVELTSIQNRLIRKAILTEIVArHVHSLGLDTVEVANALNVLGHEELSYSVIRkgENGIMSLYQ 342
gi 21362646 246 KEDIRLLKKN-KDIKIHVEFASIQDRRLRKKVVNNIFP-MVDSVGMDEAEIAYILSVLGYSDLADRIFM--YNRIEDAIL 321
gi 21362623 255 EEDIKLLKKN-KNIKTHLEFASISNIEIRKMVVDYILS-NVESVGMDETEIANVLHILGYDELSNNILK--DSFIEDVIE 330
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21362644 327 GGKILLDEMN-LDVLQIHTIYYIMYITHADNPLSEEELRRSLELATTLAASRASLGDITSPDQIEIGLRVPYNER--GEY 403
gi 21362622 343 GAVQLMKDLD-LERVHVHSLGFYICILAKGHPLTLKEHRDSLLFSSVLAAAQALNGNIENLAEAEAGLEVPVSSIglEDL 421
gi 21362646 322 GGMIILDELN-FEILQVHTIYYLMYITHRDNPLSEEELMRSLDFGTILAATRASLGDINDPRDVKVGMSVPYNER--SEY 398
gi 21362623 331 GAKILLDKFKnLEVVQVHTIYYILFVCRADNPLSKEELEECLEFSTILASTKAKLGNIRAIDDLHEGLKIPHNKY--GDL 408
                       410       420       430       440       450       460
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21362644 404 VKLRFEEAKRKLRT-----------KEYKLVIIPTRLVQNPVSTVGLGDTISTGAFASYLAMLKEK 458
gi 21362622 422 ENFQLYCTGRKLCTpdefeygyvygSEHDAILIPSKVVERPKATVGIGDTISAGAFVAMLAKIKQK 487
gi 21362646 399 IKLRFEEAKRKLRL-----------KEYKVVIVPTRLVPNPVSTVGLGDTISTGTFLSYLSLLRRH 453
gi 21362623 409 LK----EIAEKFND-----------NNYKIALSPSRYVEKPKSTVGLGDTISSGAFVYYVSLLNKK 459
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap