Conserved Protein Domain Family
gshA_cyano

?
TIGR02048: gshA_cyano 
glutamate--cysteine ligase, cyanobacterial, putative
This family consists of proteins believed (see Copley SD, Dhillon JK, 2002) to be the glutamate--cysteine ligases of several cyanobacteria, which are known to make glutathione. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 131103
View PSSM: TIGR02048
Aligned: 3 rows
Threshold Bit Score: 740.215
Threshold Setting Gi: 22297865
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499175654   3 LTKGLEVEIYTGKKTGEIVGLSDRIVRDLSGFVREPDSRNVEYTTPPLNSYDRLLCGILQPRRQLRHYLSQLGeDYTLIP 82
gi 499306727   3 LLKGFEIEMYTGTPQGEIVGLSDKIVTQLDGFVREPDSRNVEYTTDPLHSYENLLCALLRPRRALRDYLKQLG-DYTLIP 81
gi 499368599   2 LSKGFEVELYTGKPTGEIVGLSDRIVKDLPGFVREPDSRNVEFTTPPVYLYDQALCDLLRPRFRLRAYLQSLG-DLTLVP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499175654  83 GSCLALGGTDTFYRSDPQNPYHTYIEQTYSTQVVTASIHINIGIPDVEELIRACRLVRMEAPLYLALSASSPFLNGQVTG 162
gi 499306727  82 GSTLSLGRSDRFFRSDPANPYHDYIEQTYGTKVVTASVHINVGIDDPEVLMRACRLIRVEAPLFLALSASSPFIDGKATG 161
gi 499368599  81 GSTLSLGDTQRFYRSDPQNPYHTYIEQTYGTRVVTASVHINIGLREPEALMRACRLVRLEAPLFLALSAASPFLDGQVTG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499175654 163 YHSSRWQMFPKTPQEVPLFTSHGHFVQWTEEQLTLGTMQNVRHLWSAVRPNGDNRPHNLNRLELRICDLVTNPLSLLAIV 242
gi 499306727 162 YHSTRWGVFPQTPTNVPLFTSHAHHIEWVEQQLAIGTMQNVRHLWVSVRPNGDRRPYDLNRLELRICDLVTDPISLLAIT 241
gi 499368599 161 YHSTRWAIFPKTPPQVPLFTSHAHFIEWTEAQLQQGTMQNVRHLWSAVRPNGDRRPYDLNRLELRICDLVTDPIALLAIT 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499175654 243 ALLEARLQQMLADPTLDPLQQSQLTPSELLALADQNEISAAVSSLDSTLHHWRDGRAIAAREWIEELYQSVQLEAKYQGF 322
gi 499306727 242 ALLEARLLQLIENPDLDPLTQSKFSPEELVTLTAKNEAAAASASLDAQLTHWQDGRSIIARDWVNEIYQEVWAIAKKHGF 321
gi 499368599 241 ALLEARLLQLLDTPDLDPLRWG--DRETLAQLADENEQLAAKRSLEAVLTHWRDRRQLTAAAWIAELYEEVWPIAKAQGF 318
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 499175654 323 ACFLPPLRKILREGNQAQQWLTQYEQGKTPQTIVQEAILQTEMEEAILAQDLCLPLS 379
gi 499306727 322 SCFLSPLQKILREGNEAQHWLQLHKVGFDTQCVITQAISTTQERELELQNKLCTQLK 378
gi 499368599 319 SCFLVPIKKILRQGNTAQQWLAQYAAGQTIPEIMAQAVQEMAANEQEFADQLCPPLA 375
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap