Conserved Protein Domain Family
MerD

?
TIGR02054: MerD 
mercuric resistence transcriptional repressor protein MerD
This model represents a transcriptional repressor protein of the MerR family (pfam00376) whose expression is regulated by the mercury-sensitive transcriptional activator, MerR. MerD has been shown to repress the transcription of the mer operon. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 131109
View PSSM: TIGR02054
Aligned: 3 rows
Threshold Bit Score: 176.609
Threshold Setting Gi: 18076030
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 127004     1 MNAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTTGGYGLFDDAALQRLCFVRAAFEAGIGLGALARLCRALDAANCDE 80
gi 18076030   2 MNAYTISRLAEDAGVSVHVGRDYVLRGLLHPARRTESGYGIFDERSLARLRFVRAAFESGIGLDELARLCRALDADDGAD 81
gi 6689531    1 MSSYKISKLAEQAGVSVHVVRDYLLRGLLHPVRRTDSGYGIFDAQSLNRLRFVRTAFEAGIDLRELARWCQSLDGGGG-D 79
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
gi 127004    81 TAAQLAVLRQFVERRREALANLEVQLAAMPTAPAQHAESL 120
gi 18076030  82 LIGCVECLLRLVTARQAALAAVATQLAGLTHCAGEGSAYA 121
gi 6689531   80 IDECRAHLRSLIAARRETLVALDRQLAAGLPHAEPESRHA 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap