3C8L


Conserved Protein Domain Family
lin0512_fam

?
TIGR02058: lin0512_fam 
Click on image for an interactive view with Cn3D
conserved hypothetical protein
This family consists of few members, broadly distributed. It occurs so far in several Firmicutes (twice in Oceanobacillus), one Cyanobacterium, one alpha Proteobacterium, and (with a long prefix) in plants. The function is unknown. The alignment includes a perfectly conserved motif GxGxDxHG near the N-terminus. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131113
View PSSM: TIGR02058
Aligned: 5 rows
Threshold Bit Score: 155.334
Threshold Setting Gi: 17229036
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C8L_A         5 KRLIIEXGXGIDQHGQEPTIAASRAVRNAIAHNALPGVWE-VAGLSHPNEXIIEVQVAVPYP--EQVREEEVLAVLPFGR 81
gi 489817480   3 QILFIQTGFGVDVHGQNITKAAERAVRNAIFTNSMPGIQG-LLPDGDLQNMVVNIKLALPCDa-DQLDEDTIRAIIPYGT 80
gi 499377790   3 KILFIQTGMGIDVHGQNITKAATRAVQNAIWSNSMPGIEN-SLPDNSLENMNVTVRLAVPLDr-DNLDISKIKETIPYGT 80
gi 499304938   4 KRLIIEMGMGVDQHGQEPTVAAARAVRNAIAHNALPGVWE-VAGLSHPNEMIVEVQVAVPYP--EKVREEEVLAVLPFGR 80
gi 21554055   79 KLLFVEMGVGYDQHGQDVTSAAMKACKNAISSNSIPAFRRgSIPGVSFGEMKLQIKLGVPHSlhQQLDLDKVKSIFPYGK 158
                         90       100       110
                 ....*....|....*....|....*....|....*....
3C8L_A        82 KT-LTVESGGXIVQ-GRAIPELNDKNDEXLIAIAAVTVL 118
gi 489817480  81 VT-IEKMAGGMMTTsGIFLEDKEDKNDLMYIVNASVETG 118
gi 499377790  81 VE-VDITDGGMATSsGIILEDKDDENDLMYMVNAAVEVG 118
gi 499304938  81 KS-LKVEFGGMVVQ-GRAIPELNDKNDEMLVAIASVTVL 117
gi 21554055  159 IVnVEVVDGGLICSsGVLVEEMGDTNEDCYIVNVAVYVG 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap