2IX0


Conserved Protein Domain Family
RNase_B

?
TIGR02062: RNase_B 
Click on image for an interactive view with Cn3D
exoribonuclease II
This family consists of exoribonuclease II, the product of the rnb gene, as found in a number of gamma proteobacteria. In Escherichia coli, it is one of eight different exoribonucleases. It is involved in mRNA degradation and tRNA precursor end processing. [Transcription, Degradation of RNA]
Statistics
?
PSSM-Id: 131117
View PSSM: TIGR02062
Aligned: 5 rows
Threshold Bit Score: 1158.43
Threshold Setting Gi: 25091171
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IX0_A       23 DDPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVEPFL 102
gi 2507333    4 DNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVEPFL 83
gi 25091171   4 NNPLLAQLKKNLHAKTPRVEGIVKSTERGFGFLEVDAQKSYFIPPKNMKNVMHGDKISAVLKIEKDREIAEPEKLIEPFL 83
gi 1173092    4 DNPLLAQLKQQIHDSKEQVEGVVKSTDKAYGFLECD-KKTYFIAPPSMKKVMHGDKIKATIEKQGDKEQAEPEALIEPML 82
gi 25453258   4 DNPLLAQLKQKIQETLPKKEGTIKASDKGFGFLEVDSKTSYFVPPPYMKKCMHGDKVVAFIRTENEREVAEPSELIEQSL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IX0_A      103 TRFVGKVQG-KNDRLAIVPDHPLLKDA-IPCRAARGLNH-EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDHFVP 179
gi 2507333   84 TRFVGKVQG-KNDRLAIVPDHPLLKDA-IPCRAARGLNH-EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDHFVP 160
gi 25091171  84 NRFVGKIEK-KDNKLFIFPDYPFLKDF-IACRPKKSCVH-VFQTGDWAVAKLIQHKLNGNHIFYAELIEEIVKANNPLIP 160
gi 1173092   83 TRFIAKVRFnKDKKLQVLVDHPSINQP-IGAQQAKSVKE-ELQEGDWVVANLKTHPLRDDRFFYATINQLICRADDELAP 160
gi 25453258  84 TRFIGRVKL-FKGKLNVAPDHPQLKKLsLKAKTKKGLNEaDFQEGDWVVAHLVRHPLKGDDGFFVQISHKITDANDKIAP 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IX0_A      180 WWVTLARHNLEKEAPDGVATEMLDEGLV--REDLTALDFVTIDSASTEDMDDALFAKALPD----DKLQLIVAIADPTAW 253
gi 2507333  161 WWVTLARHNLEKEAPDGVATEMLDEGLV--REDLTALDFVTIDSASTEDMDDALFAKALPD----DKLQLIVAIADPTAW 234
gi 25091171 161 WWVTLSRHNLERKEPKIEKDDLILKNNSh-REDLTHLNFITIDNFNTKDIDDALFIEEIHN----GNLRLIVAIADPTSY 235
gi 1173092  161 WWVTLARHEQSRYPVRGAEPYEMLDQKT--RENLTALHFVTIDSESTMDMDDALYIEPIAQnstqTGWKLVVAIADPTAY 238
gi 25453258 163 WWVTLAENDLPNSEPAGIDDWQLKDDADlvREDLTALPFVTIDGESTKDMDDALYAQQLPN----GDFALTIAIADPTAY 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IX0_A      254 IAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKLVYD 333
gi 2507333  235 IAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKLVYD 314
gi 25091171 236 IKSGSKLDITAAKRGFTNYLPGFNVPMLPRSLSEDICSLNPHERRPVLACCITILKDGNICSKINFFLAWIKSKSKLSYD 315
gi 1173092  239 IALDSQIEQEAKQRCFTNYLPGFNIPMLPRELSDELCSLIANETRPALVCYIETDLTGNITAKPHFVSAYVQSKAKLAYN 318
gi 25453258 239 ITPEDEMDKVARERGFTIYLPGRNIPMLPRDLADELCSLMENQVRPALCCSVTIRKDGVIGDDIRFFAANIKSHARLVYD 318
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IX0_A      334 QVSDWLENTG--DWQPeSEAIAEQVRLLAQICQRRGEWRHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIVEEA 411
gi 2507333  315 QVSDWLENTG--DWQPeSEAIAEQVRLLAQICQRRGEWRHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIVEEA 392
gi 25091171 316 NVSDWIEKKS--SWKPeTKSIENQILLLHRLCLLRIKWRTSNAVLFQDSLEYRFQFSETGIVEDVVIEKRRIAHKIIEES 393
gi 1173092  319 KVSDYLEQADn-AWQPeMPETAQQIHWLHQFTKARIQWRKTHSLFFKEKPDYAFVLAENGKVQEIKAEYRRIANQIVEEA 397
gi 25453258 319 HVSDWLETGSseQWQP-SEEIAQVVRDLYAFSQARANWRETHAVVFPDRPDYRFELSADNDVVAIHADMRRTANRLVEES 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IX0_A      412 MIAANICAARVLRDKLGFGIYNVHMGFDPANADALAALLKTHG----------LHVDAEEVLTLDGFCKLRRELDAQPTG 481
gi 2507333  393 MIAANICAARVLRDKLGFGIYNVHMGFDPANADALAALLKTHG----------LHVDAEEVLTLDGFCKLRRELDAQPTG 462
gi 25091171 394 MIIANISAANFLSKNLGFGIYNTHAGFDPINAENVVSFLNNYN----------LKFTVKEITTLKGFCNLRRVLNILSDN 463
gi 1173092  398 MIIANICAAQFLHEQAKTGIFNTHSGFDKKFLENAHNFLMANLaneqnqtelaERYSVENLATLNGYCQMRHDIEPIESD 477
gi 25453258 398 MITANICAGKTLQTTFGFGVFNTHAGFKAEKMADVVELMAVNGa---------PNADAETLATVEGFAALRRWLATQETS 468
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IX0_A      482 FLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATR-PQDEITVQMAERRRLNRMA 560
gi 2507333  463 FLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATR-PQDEITVQMAERRRLNRMA 541
gi 25091171 464 YINSRIRRYQSFGDFSITPSPHFALGLVEYATWTSPIRKYSDMINHRLLKSIINQDTNITkPSEDIKLKISEQKRRNRIA 543
gi 1173092  478 YLELRLRRYLTFAEFKSELAPHFGLGLEGYATWTSPIRKYSDMVNHRLIKAVLAKQPYEK-PQNDVLARLQEARRQNRLV 556
gi 25453258 469 YLDNRIRKYQSYSEIGNQPLPHFAMGLDVYATWTSPIRKYGDMINHRLLKAHILGKAPVQtPDETVGEELALHRKHHKIA 548
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IX0_A      561 ERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVYKVT 640
gi 2507333  542 ERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVYKVT 621
gi 25091171 544 ERDISDWLYTLLLQKKEFKNKKFNAEIIDVSRSGIRAKLLENGANVFIPALFLHPIREELVFNQETGKVFIKGVLYYKIS 623
gi 1173092  557 ERDIADWLYCRYLADKVASNAEFEAEVQDVMRAGLRVQLLENGASLFIPAATLHNNKEEIQLNPDELALYIKGERTYKIG 636
gi 25453258 549 ERNVADWLYARTLADEPAKETRFQAEIFDINRPGMRVRLLENGAMAFIPGALILDNKERIECNGEDGTVLIDKEVVYKLG 628
                       650       660
                ....*....|....*....|.
2IX0_A      641 DVIDVTIAEVRMETRSIIARP 661
gi 2507333  622 DVIDVTIAEVRMETRSIIARP 642
gi 25091171 624 DLITVVLSEIRLQTRSIIARI 644
gi 1173092  637 DMVKVKLTEVKEATRSIVGEI 657
gi 25453258 629 DVLEIVLTEVNQENRSLVGKP 649
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap