3L7Z,2WNR


Conserved Protein Domain Family
ECX1

?
TIGR02065: ECX1 
Click on image for an interactive view with Cn3D
archaeal exosome-like complex exonuclease 1
This family contains the archaeal protein orthologous to the eukaryotic exosome protein Rrp41. It is somewhat more distantly related to the bacterial protein ribonuclease PH. An exosome-like complex has been demonstrated experimentally for the Archaea in Sulfolobus solfataricus, so members of this family are designated exosome complex exonuclease 1, after usage in SwissProt. [Transcription, Degradation of RNA]
Statistics
?
PSSM-Id: 131120
View PSSM: TIGR02065
Aligned: 8 rows
Threshold Bit Score: 385.641
Threshold Setting Gi: 29336868
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3L7Z_B        8 KLILDDGKRTDGRKPDELRSIKIELGVLKNADGSAIFEMGNTKAIAAVYGPKEMHPRHLSLPDRAVLRVRYHMTPFST-D 86
gi 29336819   7 RLISEDGLRLDGRKPDEMRPLKIQAGVLKRADGSAYLELGANKIVAAVYGPRELHPRHKQKPDRAVVRFRYNMAPFSV-D 85
gi 29336573   9 QLKTSPSVREDGRAFDELRPLKIEAGILERADGSSYLEFGGNKILVAVYGPREAQIRKLQRPDRAVIRCRYNMAPFSV-E 87
gi 29336899  10 KLINEDNLRLDGRSFNELRPIKIEAGVLNRADGSAYIEWGGNKIIVGVYGPKEAYPKHSQDIDHAVVKARYNMAAFSV-D 88
gi 29337007  11 KLILDDGKRTDGRKPDELRSIKIELGVLKNADGSAIFEMGNTKAIAAVYGPKEMHPRHLSLPDRAVLRVRYHMTPFST-D 89
gi 29337017   9 VELIRDGRRHDGRLPEDLRPVRMQVGILHNADGSALVEFGRTRVLAAVYGPREPHQRFYVLPDRAALRVRYHMAPFST-D 87
gi 29336868   6 VPLLQNGVRADGRTPDQMREVKIAVGVVSNADGSAMVSYGATTAVAAVYGPREMHPRHLSLPDRGVMRVRYHMAPFSTkD 85
2WNR_B        9 QLKTSPSVREDGRAFDELRPLKIEAGILERADGSSYLEFGGNKILVAVYGPREAQIRKLQRPDRAVIRCRYNMAPFSV-E 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3L7Z_B       87 ERKNPAPSRREIELSKVIREALESAVLVELFPRTAIDVFTEILQADAGSRLVSLMAASLALADAGIPMRDLIAGVAVGKA 166
gi 29336819  86 ERKRPGPDRRSIEISKLSKEALEPAIFTEYYPRTAIDIFVEVLQADAGTRCAGISAASVALADAGIEMRDLVAACAAGKV 165
gi 29336573  88 ERKRPGPDRRSVEISKITAEALRPALILEKFPRSVIDVFIEVLEAEGGTRCAGITAASVALADAGIPMRDMVVACAAGKV 167
gi 29336899  89 ERKRPGPDRRTMEISKVISEALSSSIMIEQFPRAEIDVYIEVLQADAGTRIAGLTAATVALADAGIPMRDMVVGCTAGKV 168
gi 29337007  90 ERKNPAPSRREIELSKVIREALESAVLVELFPRTAIDVFTEILQADAGSRLVSLMAASLALADAGIPMRDLIAGVAVGKA 169
gi 29337017  88 ERKSPAPSRREIELSKVVREALEPVVLAEEFPRTVIDVFLEVLQADGGTRTAAVTAASLALADAGIPMRALVGGVAVGKI 167
gi 29336868  86 ERKSPTPSRREIEISKILREALEPAIVLEQYPRSRIDVFVEILQADGSTRVASLTAASLALADAGIYMRDLVVGVSVGLV 165
2WNR_B       88 ERKRPGPDRRSVEISKITAEALRPALILEKFPRSVIDVFIEVLEAEGGTRCAGITAASVALADAGIPMRDMVVACAAGKV 167
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
3L7Z_B      167 DGVIILDLNETEDMWGEADMPIAMMPSLNQVTLFQLNGSMTPDEFRQAFDLAVKGINIIYNLEREALKSKY 237
gi 29336819 166 EGKVVLDPMYYEDGYGEADVPLAMMPKEGKITLLQMDGDMTPGEFKQAVKLAKKGCKIVYKEQRRALKEKY 236
gi 29336573 168 GDQVVLDLSEEEDKEGQADVPVAILPRTREITLLQSDGNLTPEEFERALDLAVEGCLRIHEVQKEALRKRY 238
gi 29336899 169 DGHIVLDLSKEEDNFGEADIPMAIMPKTGEIVLLQMDGDVTEDEFYEATSMIIEATKKISQIQRNALLNKY 239
gi 29337007 170 DGVIILDLNETEDMWGEADMPIAMMPSLNQVTLFQLNGSMTPDEFRQAFDLAVKGINIIYNLEREALKSKY 240
gi 29337017 168 QGVLVVDVDELEDMYGEADMPVAAAPDIGEITLLQLNGVLTGEEFRTALAMALRAIDRVVEMEKEAIRKSY 238
gi 29336868 166 DGTVVLDLNGLEDQYGEGDLPLGYMPNLKRFTLLQLDGAWTRDMFLQALNLAVRGAEYVYQIARDALKNKY 236
2WNR_B      168 GDQVVLDLSEEEDKEGQADVPVAILPRTREITLLQSDGNLTPEEFERALDLAVEGCLRIHEVQKEALRKRY 238
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap