3MMC


Conserved Protein Domain Family
dsrB

?
TIGR02066: dsrB 
Click on image for an interactive view with Cn3D
sulfite reductase, dissimilatory-type beta subunit
Dissimilatory sulfite reductase catalyzes the six-electron reduction of sulfite to sulfide, as the terminal reaction in dissimilatory sulfate reduction. It remains unclear however, whether trithionate and thiosulfate serve as intermediate compounds to sulfide, or as end products of sulfite reduction. Sulfite reductase is a multisubunit enzyme composed of dimers of either alpha/beta or alpha/beta/gamma subunits, each containing a siroheme and iron sulfur cluster prosthetic center. Found in sulfate-reducing bacteria, these genes are commonly located in an unidirectional gene cluster. This model describes the beta subunit of sulfite reductase. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 131121
View PSSM: TIGR02066
Aligned: 5 rows
Threshold Bit Score: 559.072
Threshold Setting Gi: 2459569
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3MMC_B       22 VIAKNYGKWKYHEVVKPGVIKRVAESGDVIYVVRFGTPR--LLSIYTVRELCDIADKYSDGYLRWTSRNNVEFFVTDESK 99
gi 13560125  28 IVKKNYGKWKYHEIIQPGVLVHVSETGDELYSVRVGTPR--LVSVDYIREVCDIADKYCDGYVRWTTRNNIEFLVSDKSK 105
gi 2576394   22 VMRKNFGMWKYHEHPRPGVLLHVAYSGDKIWTVKAGTQR--ILDVFTLRKLCDIGDEFADGYVHFTIRSNIEYLVSDEAK 99
gi 2459569   19 IVKRNYGKWKERKFHGPGIIEHISETGERVFTVKAALPPnaRVSVDTLEKFADIADKLGVGALRITIAGNVEFITDSLDK 98
gi 3023673   22 VIAKNYGKWKYHEVVKPGVIKRVAESGDVIYVVRFGTPR--LLSIYTVRELCDIADKYSDGYLRWTSRNNVEFFVTDESK 99
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3MMC_B      100 IDDLINEVQEr-VGFPCGGTWDAVKgeyglsNIVHTQGWIHCHTPAIDASGIVKAVMDELYEYFT-DHKLPAMCRISLAC 177
gi 13560125 106 LQPLIDDLKSrgNWFPIGGTGASVT------NIVHTQGWVHCHTPAIDASGIVKAVMDELFEYFG-SHKLPAQVRISLAC 178
gi 2576394  100 VQPLIDALEG--AGFVVGGTQNSVA------MISHTQGWLHCDIPGTDASGVVKSMMDELIDEFR-NATMPNRVHITTSC 170
gi 2459569   99 ALKIKEELEK--LGFPVGGWGGALWg------INTCTAFLTCQIAVIDAPSIGKALGDALKPYFTgEEKLPAKLRVFISG 170
gi 3023673  100 IDDLINEVQEr-VGFPCGGTWDAVKgeyglsNIVHTQGWIHCHTPAIDASGIVKAVMDELYEYFT-DHKLPAMCRISLAC 177
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3MMC_B      178 CANMCGAVHASDIAIVGIHRTPPIPNDEAIRKTCEIP-----------STVAACPTGALKP------DMKNKTIKVDVEK 240
gi 13560125 179 CLNMCGAVHCSDIAILGVHRKPPFIEHERVQNVCEIP-----------LVIAACPTAAIKPkkveidGKEYKSVEINNAR 247
gi 2576394  171 CQINCGGQ--GDIAINIQHTKPPKINHDLVANVCERP-----------SVVARCPVAAIRPam---vNGK-PSLEVDERK 233
gi 2459569  171 CPSGCAGGTAIDIAIVGMWGAPPKIREEVLPLCMPPPkalakipesqvFLVQVCPTGALTLr----rEGEKIKLVLVGEK 246
gi 3023673  178 CANMCGAVHASDIAIVGIHRTPPIPNDEAIRKTCEIP-----------STVAACPTGALKP------DMKNKTIKVDVEK 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3MMC_B      241 CMYCGNCYTMCPGMPLFDPENDGAAIMVGGKLSEARRMPELSKVVVPWVPNEPPRWPTLVKYVKQILEAWAANANKHERL 320
gi 13560125 248 CMFCGNCYTMCPALPIADGDGDGIALWVGGKVSNSRVPPMFSKLAVPYIPNEPPRWPTVVQAVKKILETYASDARRYERI 327
gi 2576394  234 CICCGACYPPCPPMQINDAEHSKLAIWVGGNHSNARGKPTFQKLVAAGIPNNPPRWPEATAIVKRILKAYKEGAKDWERI 313
gi 2459569  247 CINCGRCKDNCDAFDYD-PKDVGAAILIGGKMANTGVGPRLARVLIPWIPANPPRYEEIVAVVKKVIDVWKTHGKPGERL 325
gi 3023673  241 CMYCGNCYTMCPGMPLFDPENDGAAIMVGGKLSEARRMPELSKVVVPWVPNEPPRWPTLVKYVKQILEAWAANANKHERL 320
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....*.
3MMC_B      321 IEWVDRIGWERFFELTGLEFTQHLIDDYRITpyfYSEFRASTQFKW 366
gi 13560125 328 GEWINRIGWEKFFEKTGIEFRHEHIDDYRLA---MTTWRTTTQFKW 370
gi 2576394  314 NEWIERIGWPRFFEEVELPFTKYHIDTWRGAr---ASFNSSSYIRF 356
gi 2459569  326 ADFVERIGWAKFVELVGAPKMAAQYLWWPDAartYLTYRARGEVIF 371
gi 3023673  321 IEWVDRIGWERFFELTGLEFTQHLIDDYRITpyfYSEFRASTQFKW 366
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap