Conserved Protein Domain Family
AspKin_pair

?
TIGR02078: AspKin_pair 
Pyrococcus aspartate kinase subunit, putative
This family consists of proteins restricted to and found as paralogous pairs (typically close together) in species of Pyrococcus, a hyperthermophilic archaeal genus. Members are always found close to other genes of threonine biosynthesis and appear to represent the Pyrococcal form of aspartate kinase. Alignment to aspartokinase III from E. coli shows that 300 N-terminal and 20 C-terminal amino acids are homologous, but the form in Pyrococcus lacks ~ 100 amino acids in between. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 131133
View PSSM: TIGR02078
Aligned: 5 rows
Threshold Bit Score: 502.014
Threshold Setting Gi: 161484711
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499321698   5 PVVVKFGGTSVRYAFEEALELVANLNENTRTIVVVSALAGVTDCLLRLANG-DMSALLEIEEIHEELSQELDVQLDHLMY 83
gi 499169882   4 MIVLKFGGSSVKNDFHEAVSLTKSIFEEKEVAVVVSALKGITDMLIKYAKTfDSKYAIKIADSYVKFARTNGVDPNILSP 83
gi 499187632   7 MIVIKFGGSSLRSEFKSAVSLIKALSEEKDVVVVVSALKGITDLLEKYTDTfDSRYAVEVSKTYLEFGKRMGIDTSSLSP 86
gi 499321697   1 MIVLKFGGSSIKYDFEEATNLALSLFEDDAVIVVVSAIKGITDKLILYSQTlDKTIATKIASEYVSFAKSHGIDPVILKP 80
gi 499169881   5 LLVVKFGGSSVRYAFEEALELVKYLSERIPIVVVVSALKGVTDELIRFANG-DKGALPRIERIHEEF-------LNYHGL 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499321698  84 QLHKTLNS-KSsFPsKEAFVDEIASFGERFSAELFSEGlkilgINAKAVDSKDILFAKGDYGNAEVDFKKSVYGAGILYR 162
gi 499169882  84 HIQELFNP-PS-LP-KDALTDYILSIGELLSAVIFAEV-----VEGQVIYPWELFSAYGKFGDGFIDLKKSKKNAKIIYE 155
gi 499187632  87 YLKQLFNP-PD-LP-PQALRDYILSIGELLSAAMIAEK-----ANGAVIFPWDLFVAHGSFGNGFIDIKKSKRNVKLVKE 158
gi 499321697  81 YLDELFNL-PD-LP-EEALRDYILSLGEVLSAVIFSAS-----IGGKFVPSWDIFEAEGNFGNAFIDIKSSKKKFKRVFE 152
gi 499169881  77 NTKISISFrKD-MP-PEALRDEIISLGERISAKIFAEGlellgIKSKVVDPLEFLIAKGEFGDAYINIQESKRRAGKLIR 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499321698 163 MLRRGIVPVVTGYYGNLNGFRATFGRGGSDYSATSIARLVNAKATLIMSDVEGIYTADPKLVPSAKLIHYISYREAKIAA 242
gi 499169882 156 VIDSGKIPIVPGFVGGMDGYRVTLGRGGSDYSAVALGVILNSELVAIMSNVEGIFTADPKLVPSARLIPYLSYEEALIAA 235
gi 499187632 159 ALESGKIPIIPGFIANLNGYRVTLGRGGSDYSAVALGVLLNSELVAIMSDVEGIFTADPKMIPYSLLIPYMSYDEILIAS 238
gi 499321697 153 VLEEGYIPVIPGFTAGKDGYILTLGRGGSDYSGVAAGVLGKAKLVAIMSDVEGIYTADPKLVPSARLIPYVSYDEIIISS 232
gi 499169881 155 LIKSGVIPVIPGFYGNLNGFRVTFGRGGSDYSATALARILDSRCVLIMSDVEGIFTADPKLVPSARLIPYLSYEEIKVAA 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499321698 243 KLGMKALHHRAIDPVEG-RIPVILGKTRDLKFGTLISHKSQGIPVVVHKLIedhaeVSVVSTRRSFSLPy-eVYEEGDFY 320
gi 499169882 236 KHGMKAIQWKAAELAKEkKILMLFGRTNNWRMGTVISNRTSRMPLMTYKDG-----LLLINVEEELEYR---VIDEGPFW 307
gi 499187632 239 KYGMEAIQWKAAKLAKEyEALILFGRASDWRMGTVVSNSSSHMPLLSYDQGk----LLVMNMDSEIPYE---VVEEGEFW 311
gi 499321697 233 KHGMRALQWKAAELAKEyKIPVLFGRTRNWRMGTLMSERSSGMPLMTYKDG-----LLLVNVTEEIKYP---IIAEGPFW 304
gi 499169881 235 KLGMKALHWKAVDPVVG-DIPIIFGKTKDWKFGTIVLNARSNFPIIVHRVRedfaeIFVVG--RNISLPgflVEEEREDF 311
                        330       340
                 ....*....|....*....|..
gi 499321698 321 FKIKIPKEQFLEVLKDIHRRVV 342
gi 499169882 308 KLYDVPGNEGIRIIRELHKAIF 329
gi 499187632 312 RVYRVPKRDSIKIIKELHRKII 333
gi 499321697 305 KLYKVSQEEGIHLMRELHTKLF 326
gi 499169881 312 VKIVVAREDLPEAIREIHREVV 333
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap