1CS1


Conserved Protein Domain Family
O_succ_thio_ly

?
TIGR02080: O_succ_thio_ly 
Click on image for an interactive view with Cn3D
O-succinylhomoserine (thiol)-lyase
This family consists of O-succinylhomoserine (thiol)-lyase, one of three different enzymes designated cystathionine gamma-synthase and involved in methionine biosynthesis. In all three cases, sulfur is added by transsulfuration from Cys to yield cystathionine rather than by a sulfhydrylation step that uses H2S directly and bypasses cystathionine. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 131135
View PSSM: TIGR02080
Aligned: 6 rows
Threshold Bit Score: 661.496
Threshold Setting Gi: 334318107
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CS1_A         2 TRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRALAELEGGAGAVLTNTGMSAIH 81
gi 127030      2 TRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRALAELEGGAGAVLTNTGMSAIH 81
gi 446135386   3 TRKPATIAVRTGIESDTQYHAVVPPIYLSTNYGFPAFGEVPKYDYTRSGNPNRGLLEQTLYELECGEGAVVTNCGTSAIN 82
gi 33504380    2 KNNKSTVSVRSGLNNDKQHGCVVSPITLSTTYNFFEFNKPRLYDYSRRKNPTRDIVQKTVADLEQGKNAIITSSGMSAIY 81
gi 499386302   9 eRQLATLAVRQGIESDTQYGAVVPPIYLSTNYAFDGHKNPREFDYSRSGNPTRSILGDALAKLEKGATGVVTCTGMAAIT 88
gi 503610887   8 SDRAETTAAAHGVATDPAFGSVVPPLYLSSTYEFAGFDTPRAYDYGRSGNPTRDLLAQALAKLEGGADAVVTPSGMAA-L 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CS1_A        82 LVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGDEQALRAALAEK-PKLVLVESPSNPLLRVVDIAKIC 160
gi 127030     82 LVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGDEQALRAALAEK-PKLVLVESPSNPLLRVVDIAKIC 160
gi 446135386  83 LWVTALLGPDDLIVAPHDCYGGTYRLLNTRAKKGDFKVQFVDQSNAAALTQALARK-PKLLLIETPSNPLVRVVDIAHLC 161
gi 33504380   82 LICIALLNSDDCLIAPYDCYGGTYRLLNALNSKKVCRVQFVNQNDTELMLKCLKQKdVKLVFIETPSNPMLRVVDIRYMC 161
gi 499386302  89 LVTT-LLGPDDLLVVPHDCYGGSYRLFTNLAKKGQFKLLVVDQTDNQALAQAIAQQ-PKMVWIETPSNPLLRVVDIEAIA 166
gi 503610887  87 DLLLGRLRRNHLVLAPHDCYGGTLRLLKARADLGHLTFRLTDQRDFGGFEAALSDA-PALVLIESPSNPLMRVTDIARLS 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CS1_A       161 HLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTXYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYL 240
gi 127030    161 HLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYL 240
gi 446135386 162 QLAKAQGTLVAVDNTFLTPVFQKPLTLGADFVLHSTTKYINGHSDVIGGVLICKHKQHAEELAWWGNCLGSTGTPFDSYM 241
gi 33504380  162 SLKERDDIVYVVDNTFMTPIFQNPLNLGADLVVHSCSKYLNGHSDVILGAVISKDIYLHEKLMWWSNALGITGGAFDSYQ 241
gi 499386302 167 KASHGVGALVVVDNTFLSPILQQPLLLGADIVIHSTTKYINGHSDVVGGAVIAKDPQIGETLHWWSNTLGLTGSAFDSYQ 246
gi 503610887 166 TLAKAAGSAVAVDNTFLSPALQQPLSLGADYAIHSATKFLNGHSDVIAGAVIAAEPQEAHDLKRWANVTGAVAAPFDAWL 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CS1_A       241 LLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDGDEQTLRRFLGGLSL 320
gi 127030    241 LLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDGDEQTLRRFLGGLSL 320
gi 446135386 242 TLRGIRTLGARMRVHEESAQQILAYLQTQSLVSKIYHPSLPDHPGHEIAKKQQSGFGAMLSFEFAGSFEQLKFFVGKLAL 321
gi 33504380  242 LLRGIRTLSIRVCQQQCNTKNIVDFLLKQPQIKSIYYPGLYSHVGYKIACQQQTGFGSIFSFELKGTEGVVSKFLKSLKL 321
gi 499386302 247 TLRGLRTLAVRIREHQRNAQRIVELLSNSPVVSKVYYPGLADHPGHAIAAKQQKGFGAMLSFELKGGEAEVVAFLDALSL 326
gi 503610887 246 TLRGLRTLFARMSSQERSAMTIAEYLDAHPAVRHVHYAGLPDHADHEVARRQQRGFGAMMSFELEGGVPAVRRFLAHIRC 325
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
1CS1_A       321 FTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADLENGFRAA 383
gi 127030    321 FTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADLENGFRAA 383
gi 446135386 322 FSLAESLGGVESLICHPASMTHRAMGEEALAEAGISQQLLRLSVGLEDASDLIADLDQAFLHT 384
gi 33504380  322 FTLAESFGGVESLIAHPETMTHAAMSKQSRDTAGINNMLLRVSVGLEDSVDLINDLDQALQSI 384
gi 499386302 327 FSVAESLGGVESLVAVPATMTHRAMEPQARFEAGIKDTLLRLSVGIEDADDLVADIQAGLAAV 389
gi 503610887 326 FTLAESLGGVESLVAHPATMTHLDMGPEARERAGIRDELLRLSIGLEHIDDLMEGLELGLGAC 388
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap