Conserved Protein Domain Family
leud

?
TIGR02084: leud 
3-isopropylmalate dehydratase, small subunit
Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures. All are dehydratases (EC 4.2.1.-) and bind a Fe-4S iron-sulfur cluster. 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble the leuC and leuD pair in length and sequence but even more closely resemble the respective domains of homoaconitase, and their identity is uncertain. The members of the seed for this model are those sequences which are gene clustered with other genes involved in leucine biosynthesis and include some archaea. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 131139
View PSSM: TIGR02084
Aligned: 5 rows
Threshold Bit Score: 293.237
Threshold Setting Gi: 8134550
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7994624    7 GRVWKFGDNVDTDQIIPARYLNTSDPYELAKHVMEDSEHpEF-AKEHKEGDIIVAGKNFGSGSSREHAPIAIKYSGVPVV 85
gi 23396668   5 GDVLKYGDNIDTDVIIPARYLNTSVPEELAKHCMEDLDV-DF-LKKLKTGDIVVGGRNFGCGSSREHAPICIKAAGVSCV 82
gi 23396645   3 GKAIKYGDNIDTDVIIPARFLNTSDPKELAEHCMEDLDR-EF-KNKVKEGDILVVGENFGCGSSREHAPLAIKASGISCI 80
gi 32262685   5 GFVHKYGDNVDTDVIIPARYLNTADHKELANHCMEDIDK-DF-VAKVKEGDIMVGGWNFGCGSSREHAPIAIKASGISCI 82
gi 8134550    7 GKVFVFGDNVNTDEIIPARYLNTSDPQELAKYCMEDARP-GFgRRDDIKGSIIVAGENFGCGSSREHAPVAIKAAGISCV 85
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7994624   86 IAKSFARIFFRNAINIGLPIVEAPEAVDEIEHGDEIEVDLEKGVIKNLRTGKEYQATKFPKELQDILKAGGLMAYAKE 163
gi 23396668  83 IAKSFARIFYRNSINIGFPILECEEAVNDASTGDKLEVDFIEGIIKNVTLNKEYKAQPFPDFMLKIMKNEGLTNCVKK 160
gi 23396645  81 IAKSFARIFYRNAINIGLPILESREAVDGIEEGDIVSVDVDNGIIRNVTKGTEFKAQPFPEFIKEIIKYGGLINYVRE 158
gi 32262685  83 IAKSFARIFYRNAINIGLAIIESEEVAQSLENGDEVAIDFDKGIITNCKNNQQFSTTPFPPFIQEIINANGYLNWISK 160
gi 8134550   86 IAKSFARIFFRNAINIGLPIVELKEA-DEFEEGDIAEVDLENGVVRNLTKGKEYRIRPYPEFLMKIMEAGGWLEYCLK 162
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap