Conserved Protein Domain Family
meth_trns_rumB

?
TIGR02085: meth_trns_rumB 
23S rRNA (uracil-5-)-methyltransferase RumB
This family consists of RNA methyltransferases designated RumB, formerly YbjF. Members act on 23S rRNA U747 and the equivalent position in other proteobacterial species. This family is homologous to the other 23S rRNA methyltransferase RumA and to the tRNA methyltransferase TrmA. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 131140
View PSSM: TIGR02085
Aligned: 4 rows
Threshold Bit Score: 693.121
Threshold Setting Gi: 20455420
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175340    3 DCRYYQQNECRSCQWLEIPCSQQLTEKQYHLKQQLIsiNYDEAQWVAPFQSNQQGFRNKAKMVVSGSVERPILGILKNPN 82
gi 2501407    2 QCALYDAGRCRSCQWIMQPIPEQLSAKTADLKNLLA--DFPVEEWCAPVSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDG 79
gi 20455400   2 HCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLA--GHAVTQWLAPVFGRESAFRNKAKMVVSGSVERPLLGMLHRDG 79
gi 20455420   2 QCEFFIQKRCTSCHLCAQPYSEQVTNKDQQLRELIAp--ATDVQWLPPVTSADTAFRNKAKMVVLGAAHAPILGIEDAQG 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175340   83 DPqsaIDLCDCPLYPTHFSAIFSILKDFIGRAGLVPYNIAKQKGELKYILLTESIATEKLMLRFVLRTENKLPLIRRELP 162
gi 2501407   80 TP---EDLCDCPLYPASFAPVFAALKPFIARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALP 156
gi 20455400  80 TP---VDLCACPLYPPSFEPVFTVLKTFIARAGLTPYNVARKRGELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALP 156
gi 20455420  80 QP---LSLVTCPLYPQPMQELLAYLENWIRIAGIPPYNKLKKKGELKFILLTRSENSGQFMLRFVARSHAVLERIERNLP 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175340  163 KLLEKLPHLEVISINLQPQHAAILEGEQEIFLTEQQFLPENFNGIPLFIRPRGFFQTNPKVAAGLYATAQQWVAEFPIYN 242
gi 2501407  157 WLHEQLPQLKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYATARDWVRQLPVKH 236
gi 20455400 157 WLQQQLPQLAVISANIQPVHMAILEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPQVAASLYATARQWVQEHEVHS 236
gi 20455420 157 TLIAAFPMIEVISVNIQPVHMARLEGEEEIFLTETQSLLEHFNDVPMVIRPKSFFQTNPKVAEQLYATARTWVREIAPTQ 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175340  243 LWDLFCGVGGFGLHCAkalqekwGKPIKLTGIEISSSAILAASHSAKILGLEHVNFQSLDAASVIENKNeNKPDLVIVNP 322
gi 2501407  237 MWDLFCGVGGFGLHCA-------TPDMQLTGIEIASEAIACAKQSAAELGLTRLQFQALDSTQFATAQG-DVPELVLVNP 308
gi 20455400 237 MWDLFCGVGGFGLHCA-------GPETQLTGIEINAEAIACARQSAEQLGLKNVSFAALDSTRFATAEA-QIPELVLVNP 308
gi 20455420 237 MWDLFCGVGGFALHCA-------APDTAVTGIEIEPEAIASAQRSAQMMGIDNLSFAALDSAKFSQSQM-SAPELVLVNP 308
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1175340  323 PRRGIGKELSEFLNQIQPHFILYSSCNAMTMGKDLQHLTCYKPLKIQLFDMFPQTSHYEVLVLLER 388
gi 2501407  309 PRRGIGKPLCDYLSTMAPRFIIYSSCNAQTMAKDIRELPGFRIERVQLFDMFPHTAHYEVLTLLVK 374
gi 20455400 309 PRRGIGRELCDYLSQMAPKFILYSSCNAETMAKDISLLAGYHIERVQLFDMFPHTSHYEVLTLLTL 374
gi 20455420 309 PRRGLGSELTAQLEALAPKYILYSSCNPQTMVKDIAELSSYQMIRVQWFDMFPHTDHAEVLTLLVR 374
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap