1VBV


Conserved Protein Domain Family
yccV

?
TIGR02097: yccV 
Click on image for an interactive view with Cn3D
hemimethylated DNA binding domain
This model describes the small protein from E. coli YccV and its homologs in other Proteobacteria. YccV is now described as a hemimethylated DNA binding protein. The model also describes a domain in longer eukaryotic proteins.
Statistics
?
PSSM-Id: 131152
View PSSM: TIGR02097
Aligned: 10 rows
Threshold Bit Score: 140.971
Threshold Setting Gi: 4335771
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VBV_A         3 ASKFGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVN-DEL-RAAPWYHVVMEDDNGLP-VHTYLAEAQLSSELQD 79
gi 3025052    20 ASKFGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVN-DEL-RAAPWYHVVMEDDNGLP-VHTYLAEAQLSSELQD 96
gi 33504218    3 ASKFKIGQQVRHKLLGYLGVVIDIDPEYSLEKPTLDEVTKN-DSL-RKFPWYHVVMEDDEGKP-IHTYLAEIQLGYEDTV 79
gi 218512038 500 DVCYSIGLIMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHsLPHgHHQPFYNVLVEDGSCR-----YAAQENLEYNVEP 574
gi 14530590   41 HVEFRVGDVITHTKLNFRGVIIGWDEHAIAPEKFLKVAHGEnKNY-ATQPNYAVLIDTRDRLTpQLSYIVQENLEIDKG- 118
gi 499211901  70 TAKFAIGQVVRHRLFPFRGIIFDVDPQFANTDEWYEAIPADvRPR-KDQPFYHLLAENSETE--YIAYVSEQNLLEDRSG 146
gi 489623612   5 NAKFEIGQVVRHRMFPFRGVVFDVDPEYANTEEWWNAIPQEiRPE-KDQPFYHLFAENDESE--YVAYVSEQNLVSDDSD 81
gi 499221947   5 lAKFAIGQVVRHRIFPFRGVVFDVDPVFANTEEWWQSIPEDiRPT-KDQPFYHLLAENEDNS--YVAYVSEQNLLPDDSG 81
gi 493357783   5 DAKFTLGEIVRHKVFPFRGVVIDVDPEYANTEEWWNAIPAEiRPE-RDQPFYHLLAENEETE--YVAYVSEQNLVHDEND 81
gi 4335771    93 EYAFRLGQKLRHKTFGYRAVVCGMDPICSESSSWMEAAEVEkLPRgSNQPFYQVLVDVRTHPDlLVAYVAEDNLLAPEKP 172
                         90       100
                 ....*....|....*....|....*
1VBV_A        80 --EHPEQPSMDELAQTIRKQLQAPR 102
gi 3025052    97 --EHPEQPSMDELAQTIRKQLQAPR 119
gi 33504218   80 --IHPEQSTLDDLAESIRLQLQTPR 102
gi 218512038 575 --QEISHPDVGRYFSEFTGTHYIPN 597
gi 14530590  119 ---TVMHPLVDKFFDGFDEKRQKLV 140
gi 499211901 147 --EPVRHPQIKEMFDKRPDGRYEPK 169
gi 489623612  82 --RPIRHPQVDALFEKADAGHYKPK 104
gi 499221947  82 --EPIGHPQTAVIFESFDHGLYKLR 104
gi 493357783  82 --TPLRNPNIGRIFDKAPNGEWRPK 104
gi 4335771   173 dkERFDHPYISFLYYGADTAGDFIP 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap