Conserved Protein Domain Family
MJ0042_CXXC

?
TIGR02098: MJ0042_CXXC 
MJ0042 family finger-like domain
This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Statistics
?
PSSM-Id: 131153
View PSSM: TIGR02098
Aligned: 10 rows
Threshold Bit Score: 53.1399
Threshold Setting Gi: 15811180
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|
gi 15811180    1 MRIECKNCKAVYRIDNSKIPINGKkvKVKCTNCNTTWMHI 40
gi 34102291    3 YTTQCPNCQTRFKVNDSQLAAADG--LVRCGRCSHVFKAP 40
gi 2495758     1 MNVKCPECGAWIYVVEEDSGGDAM--EVKCPKCGTSIYVV 38
gi 27804873    1 MRFVCDSCRAQYMISDDKIGPKGV--KVRCKKCGHTITVR 38
gi 6647927     1 MYITCPNCKTQFIVTSNQIGINGR--RVKCSKCKHLWYQK 38
gi 27349641    7 MHIVCPHCTTSYAIKLASLGANGR--TVRCSRCKQTWVAY 44
gi 594552761   9 MILTCPECASRYFVDDSKVGPDGR--VVRCASCGNRWTAF 46
gi 499257890   5 FVTQCPHCQTSFRVTHHQLGVARG--VVRCGHCLQVFNAA 42
gi 489216835   5 VITQCPHCSTSFRVNDAQLGAANG--AVRCGTCLKVFNAL 42
gi 544726376   7 LAARCPACHTAFRVVADQLRLRGG--LVRCGRCNHVFDGR 44
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap