Conserved Protein Domain Family
PQQ_syn_pqqC

?
TIGR02111: PQQ_syn_pqqC 
coenzyme PQQ biosynthesis protein C
This model describes the coenzyme PQQ (pyrrolo-quinoline-quinone) biosynthesis protein PqqC.In contrast to the broader model pfam05312, this model does not include related proteins likely to be functionally distinct from PqqC, such as homologs found in the Chlamydias. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131166
View PSSM: TIGR02111
Aligned: 5 rows
Threshold Bit Score: 427.72
Threshold Setting Gi: 32129889
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32129899   5 LSPDQLEADLRAIGArLYHDQHPFHALLHHGKLNRGQVQAWALNRFEYQRCIPLKDAAILARMEDPALRRIWRQRILDHD 84
gi 32129889   7 MSPAEFEQALRAKGA-YYHIHHPYHVAMYQGRATREQIQGWVANRFYYQVNIPMKDAAILANCPDREVRREWIQRLLDHD 85
gi 130793     8 LTTEQFKQAIIDKGQ-YYHIYHPFHVMMYEGKATQQQIQAWVANRYYYQINIPLKDAAIMANCPDQRVRQEWIQRMIDQD 86
gi 32129863  17 LSHEELEAALRDIGArRYHNLHPFHRLLHDGKLSKDQVRAWALNRYYYQAMIPVKDAALLARLPDAQLRRIWRQRIVDHD 96
gi 32129910   5 TDRQAFHARLLEIGKeRYHDKHPFHAMLHGGGCTTTQVRAWVINRYYYQSRIPMKDAAFLSRCDDPDMRRAWRSRIEDHD 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32129899  85 GNSPSDGGIARWLHLTDALGLPRELVESGRALLPGTRFAVQAYLHFVREKSLLEAIASSLTELFAPNIIGQRVAGMLQHY 164
gi 32129889  86 GAPGEDGGIEAWLRLGQAVGLDPDQLRSQELVLPGVRFAVDAYVNFARRASWQEAASSSLTELFAPQIHQSRLDSWPQHY 165
gi 130793    87 GEYPDGGGREAWLRLAEAVGLSREQVISEELVLPGVRFAVDAYVNFRRRASWREAASSSLTELFAPQIHQSRLDSWPQHY 166
gi 32129863  97 GDHEGDGGIERWLKLAEGVGFTRDYVLSTKGILSATRFSVDAYVHFVSERSLLEAIASSLTEMFSPTIISERVAGMLKNY 176
gi 32129910  85 GGVEEGGGIRRWLRLAEAVGLDPAYVGSARGVLPSTRFAVDAYVSFVREKPLLEAVASSLTELFAPKIHSERIAGLLEHY 164
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 32129899 165 DFVSPEALAYFEHRLTEAPRDSDFALDYVKQHADTIEKQQLVKAALHFKCSVLWAQLDALHVAYVSpgVVWPDAFVPER 243
gi 32129889 166 PWIDPAGYEYFRTRLGQARRDVEHGLAITLQHYTTRAGQERMLEILQFKLDILWSMLDAMSMAYEL--NRPPYHSVTQE 242
gi 130793   167 PWIDDKGYEYFRSRLSQARRDVEHGLTITLDSFTTFEQQERMLEILQFKLDILWSILDALTLAYVH--NEAPYHSVTSK 243
gi 32129863 177 DFITKDTLAYFDKRLTQAPRDADFALDYVKRHATTPEMQRAAIDALTFKCNVLWTQLDALYFAYVApgMVPPDAWQPGE 255
gi 32129910 165 AFADDAALAYFRQRLAEVPRDVEFGLAYVLDHADTREKQDAAAQALTFKTDVLWAQLDALYSAYVTpgRIPPGAWDGRE 243
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap